KEGG   Ailuropoda melanoleuca (giant panda): 100481376Help
Entry
100481376         CDS       T01329                                 

Gene name
PRKAA2
Definition
(RefSeq) protein kinase AMP-activated catalytic subunit alpha 2
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04068  FoxO signaling pathway
aml04140  Autophagy - animal
aml04150  mTOR signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04152  AMPK signaling pathway
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04371  Apelin signaling pathway
aml04530  Tight junction
aml04710  Circadian rhythm
aml04714  Thermogenesis
aml04910  Insulin signaling pathway
aml04920  Adipocytokine signaling pathway
aml04921  Oxytocin signaling pathway
aml04922  Glucagon signaling pathway
aml04931  Insulin resistance
aml04932  Non-alcoholic fatty liver disease (NAFLD)
aml05410  Hypertrophic cardiomyopathy (HCM)
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    100481376 (PRKAA2)
   04068 FoxO signaling pathway
    100481376 (PRKAA2)
   04151 PI3K-Akt signaling pathway
    100481376 (PRKAA2)
   04152 AMPK signaling pathway
    100481376 (PRKAA2)
   04150 mTOR signaling pathway
    100481376 (PRKAA2)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100481376 (PRKAA2)
  Cellular community - eukaryotes
   04530 Tight junction
    100481376 (PRKAA2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100481376 (PRKAA2)
   04922 Glucagon signaling pathway
    100481376 (PRKAA2)
   04920 Adipocytokine signaling pathway
    100481376 (PRKAA2)
   04921 Oxytocin signaling pathway
    100481376 (PRKAA2)
  Aging
   04211 Longevity regulating pathway - mammal
    100481376 (PRKAA2)
   04213 Longevity regulating pathway - multiple species
    100481376 (PRKAA2)
  Environmental adaptation
   04710 Circadian rhythm
    100481376 (PRKAA2)
   04714 Thermogenesis
    100481376 (PRKAA2)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100481376 (PRKAA2)
   05410 Hypertrophic cardiomyopathy (HCM)
    100481376 (PRKAA2)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100481376 (PRKAA2)
   04931 Insulin resistance
    100481376 (PRKAA2)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100481376 (PRKAA2)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   100481376 (PRKAA2)
Membrane trafficking [BR:aml04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100481376 (PRKAA2)
Mitochondrial biogenesis [BR:aml03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100481376 (PRKAA2)
  Mitophagy factors
   Other mitophagy factors
    100481376 (PRKAA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like RIO1 Kdo APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100481376
NCBI-ProteinID: XP_011233224
Ensembl: ENSAMEG00000017253
Position
Un
AA seq 637 aa AA seqDB search
MSLSKGKKQLTKDYRGPYIVTFPDGPQSVRKSRGKRARCRAETAAELCCSGRAGLARVRL
RERVSGQRGRSAAFLGCCLLNEWELLRARPLRSACPNSNFSSSSSCCRRGCCCGRLVGEH
QLTGHKVAVKILNRQKIRSLDVVGKIKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEY
VSGGELFDYICKHGRVEEVEARRLFQQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKI
ADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFD
DEHVPTLFKKIRGGVFYIPEYLNRSVATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSY
LFPEDPSYDANVIDDEAVKEVCEKFECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMN
QASEFYLASSPPTGSFMDDSTMHIPPGLKPHPERMPPLIADSPKARCPLDALNTTKPKSL
AVKKAKWHLGIRSQSKPYDIMAEVYRAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSL
QLYLVDNRSYLLDFKSIDDEVVEQRSGSSTPQRSCSAAGLHRPRSSFDSVTAESHSLSGS
LTGSLTGSTLSSVPPRLGSHTMDFFEMCASLITTLAR
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgtccctttccaaggggaaaaagcaactcaccaaagactaccgtggtccctacattgtg
actttcccagatgggccccaaagcgtccgaaagtccagggggaagagagcccgctgccga
gcagaaactgctgcagagctgtgctgctcggggcgcgctgggctggcgcgtgtccggctg
cgcgagcgggtgagtgggcagcgcgggcgctcggccgccttcctcggctgctgcttactt
aatgaatgggagctgctccgagcccggccgctccggagcgcctgccccaactccaacttt
tcttcctcctcctcctgctgccgccgcggctgctgttgtggtcgcctggttggagaacat
caattgacaggccataaagtggcagttaaaatcttaaatagacagaagattcgcagttta
gatgttgttggaaaaataaaacgagaaattcaaaacctaaaactctttcgtcatcctcat
ataatcaaactataccaggtgatcagcactccaacagatttttttatggtgatggaatat
gtgtctggtggtgaattatttgactacatctgtaaacatggacgggttgaagaggtggaa
gcaaggcggctctttcagcagattctgtcagctgtggattactgtcataggcatatggtg
gttcatcgagacctgaaaccagagaatgtgctgttggatgctcacatgaatgccaagata
gctgattttggattgtctaatatgatgtcagatggtgaatttctgcgaaccagttgtgga
tctccaaattatgcagcacctgaagtcatctcaggcagattgtatgcaggtcctgaagtt
gatatctggagctgtggtgttattttgtatgcccttctttgtggcaccctcccatttgat
gatgagcatgtacctacgttatttaagaagatccgagggggtgttttttatatcccagaa
tatctcaatcgttctgttgccactctcttgatgcatatgctgcaggttgaccccctgaaa
cgagcaaccatcaaagatataagagagcatgaatggtttaaacaagatttgcccagttac
ttatttcctgaagacccctcctatgatgctaacgtcattgatgatgaggctgtgaaagaa
gtgtgtgaaaaatttgagtgtacagaatcagaagtaatgaacagtttatatagtggtgac
cctcaagaccagcttgcagtggcttatcatcttatcattgacaatcggagaataatgaac
caagccagtgagttctacctcgcctctagtcccccaacaggttcttttatggatgatagt
accatgcatattcccccaggcctgaaacctcatccagaacggatgccacctcttatagca
gacagccctaaagcgagatgtccattggatgcactgaacacaactaagcccaaatcttta
gctgtgaaaaaagccaagtggcatcttggaatcagaagtcaaagcaaaccgtatgacatt
atggctgaggtctaccgagctatgaagcagctggattttgaatggaaggtagtgaatgca
taccatcttcgtgtaagaaggaaaaatccagtgactggcaattatgtgaaaatgagctta
caactttacctggttgacaacagaagctatcttttggactttaaaagcattgatgatgag
gtggtggagcagaggtctggttcttcaacacctcagcgttcctgttctgctgctggctta
catagaccaagatcaagttttgattctgtaactgcagagagccattcactttctggctct
ctcactggctctttgaccggaagcacattgtcttcagttccaccccgcctaggcagtcac
accatggatttttttgaaatgtgtgccagtctgatcactaccttagcccgttga

DBGET integrated database retrieval system