KEGG   Ailuropoda melanoleuca (giant panda): 100481825Help
Entry
100481825         CDS       T01329                                 

Gene name
ACSS2
Definition
(RefSeq) acyl-CoA synthetase short-chain family member 2
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00010  Glycolysis / Gluconeogenesis
aml00620  Pyruvate metabolism
aml00640  Propanoate metabolism
aml01100  Metabolic pathways
aml01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100481825 (ACSS2)
   00620 Pyruvate metabolism
    100481825 (ACSS2)
   00640 Propanoate metabolism
    100481825 (ACSS2)
Enzymes [BR:aml01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     100481825 (ACSS2)
Lipid biosynthesis proteins [BR:aml01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   100481825 (ACSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 100481825
NCBI-ProteinID: XP_002916445
Ensembl: ENSAMEG00000009268
Position
Un
AA seq 701 aa AA seqDB search
MGLPEERGRSGSGSAEREEAGARNRVRSWSPPPEVSRSAHVPSLQRYRELHRRSVEQPRE
FWGDIAKEFYWKTSCPGPFLQYNFDVTKGKIFIEWMKGATTNICYNVLDRIVHEKKLGDK
VAFYWEGNEPEETTQITYRELLVQVCRCSNVLQKQGIRKGDRVAIYMPMIPELVVAMLAC
ARLGALHSIVFAGFSAESLCERILDSSCSLLITTDAFYRGEKLVNLKELADEALDKCREK
GFQVRCCIVVKHLGRAELGTGDSPSQSPPIKRPCPDVQISWNQGVDLWWHELMQEAEDEC
EPEWCDAEDPLFILYTSGSTGKPKGVVHTVGGYMLYVATTFKYVFDFHAEDVFWCTADIG
WITGHSYVTYGPLANGATSVLFEGIPTYPDVSRLWSIVDKYKVTKFYTAPTAIRLLMKFG
EEPVTRHSRASLQVLGTVGEPINPEAWLWYHRVVGAQRCSIVDTFWQTETGGHMLTPLPG
ATPMKPGSATFPFFGVAPAILNESGEELEGEAEGYLVFKQPWPGIMRTVYGNHERFEATY
FKKFPGYYVTGDGCRRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAIAEAAVV
GHPHPVKGECLYCFVTLCDGYTFSPTLTEELKKQIREKIGPIATPDYIQNAPGLPKTRSG
KIMRRVLRKIAQNDHDLGDTSTVADPTVICQLFNHRCLTIQ
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atggggcttccggaggagcggggccgaagcggcagcgggagcgcggagcgggaggaggct
ggagcccggaaccgggtgcggagttggtctccgccgcccgaggtcagccgttccgcgcac
gtcccgtcgctgcagcgctaccgcgagctgcaccggcgctcagtggagcagccgcgagag
ttttggggagacattgccaaggaattttactggaagacttcatgtcctggcccattcctc
cagtacaattttgatgtgactaaaggaaaaatcttcatcgagtggatgaaaggagcaact
actaacatctgctacaacgtactggatcgaattgtccacgagaagaaacttggagataaa
gttgctttttactgggagggcaacgaaccagaggagaccacccagatcacatatcgtgag
ctactggtccaagtgtgtcgatgcagcaatgttctccaaaaacagggcattcggaagggt
gaccgagtggccatctacatgcccatgataccggagcttgtggtggccatgctggcatgt
gcccgccttggggctctgcactccattgtgtttgcaggcttctctgcagagtctctatgt
gaacggatcctggattccagttgcagccttcttatcactacagatgccttctacaggggg
gaaaagcttgtgaacctcaaggagctggctgacgaggccctggacaagtgtcgggagaag
ggtttccaagtgagatgctgcattgtggtcaagcacctggggcgggcagagctgggcaca
ggtgactctcccagccaatccccccccattaagaggccttgcccggatgttcagatctcc
tggaaccaaggggttgacttgtggtggcatgaactcatgcaagaggcagaggatgagtgt
gagcctgagtggtgtgatgctgaggacccactcttcatcctgtacaccagtggctccaca
ggcaaacccaagggtgtggtacatactgttgggggctacatgctctatgtggccacgacc
ttcaagtacgtgtttgacttccatgcggaggatgtgttctggtgcacagcagacattggg
tggatcaccggccattcctatgtcacctatgggccactggccaatggtgccaccagtgtt
ttgtttgaggggattcccacatacccggatgtgagccgcctgtggagcatcgtggacaag
tacaaggtgaccaagttctacacagcacccacagctatccgcctgctcatgaagtttgga
gaggagcctgtcacccggcatagccgggcatccttacaggtgttaggtacagtgggtgaa
cccattaaccctgaggcctggctgtggtaccaccgggtggtaggtgcccagcgctgttcc
atcgtggacaccttctggcaaacagagacaggtggccatatgctgacccccctccctggt
gccacaccaatgaagcctggttctgctaccttcccgttctttggtgtagctcctgcaatt
ttgaatgagtctggggaagagttggaaggtgaagctgaaggttacctggtgttcaagcag
ccctggccaggaatcatgcgcacagtctatgggaatcatgaacgctttgaggccacctac
tttaagaagttccctggttactatgtgacaggagatggctgccggcgggaccaggatggc
tattactggatcactggcaggatcgatgacatgctgaatgtatctggacatctgctgagc
acagcggaggtggaatcagcactcgtggaacatgaggctattgcagaggcagctgtggtc
ggccaccctcatcctgtgaagggcgaatgtctctactgctttgtcaccctgtgcgatggc
tacaccttcagccccaccctcaccgaggagctcaagaagcaaattagagaaaagattggc
cccattgccactccagattatatccagaatgcacccggcttgcctaaaacccgctcaggg
aaaatcatgaggcgggtgcttcggaagattgctcagaatgaccacgacctgggggacacg
tctactgtggctgacccaactgtcatctgccagctcttcaaccaccgatgcctgaccatc
caataa

DBGET integrated database retrieval system