KEGG   Ailuropoda melanoleuca (giant panda): 100482093
Entry
100482093         CDS       T01329                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00230  Purine metabolism
aml00240  Pyrimidine metabolism
aml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100482093 (DCK)
   00240 Pyrimidine metabolism
    100482093 (DCK)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     100482093 (DCK)
SSDB
Motif
Pfam: dNK AAA_18 AAA_28 Thymidylate_kin AAA_33 Phage_lysozyme CoaE
Other DBs
NCBI-GeneID: 100482093
NCBI-ProteinID: XP_002919554
Ensembl: ENSAMEG00000005937
Position
11
AA seq 260 aa
MATPPKRSCPSPATGSEGTRIKKIAIEGNIASGKTTFVNILKQVCEDWEVVPEPVARWCN
VQNAQGDCEELTTSQESGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLACLDGKLKDAE
KPVLFFERSIYSDRYVFASNLYESECMNETEWTIYQDWHDWMNQQFGQSLVLDGIIYLRA
TPEKCLNRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDFLQEIPILTLDINE
DFKDKHDGLIEKVKEFLSTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atggccaccccaccgaagaggagctgcccatctcccgcgaccggttctgaggggacccgc
atcaagaaaattgccatcgaagggaacattgcttcagggaagacaacatttgtgaatatc
cttaaacaggtctgcgaagattgggaagtggttccggaacctgttgccaggtggtgcaat
gttcagaatgctcaaggtgactgtgaggaactgacgacgtctcaggaaagtggtggaaat
gttcttcagatgatgtacgaaaaacctgaacgatggtcttttacgttccagtcatatgcc
tgcctcagtcgaatacgagcccagcttgcctgtcttgatggcaagctcaaagatgcagag
aaacctgtattattttttgaacgatctatatatagtgacaggtatgtctttgcatctaat
ttgtatgaatctgaatgcatgaatgaaacagagtggacaatttatcaagactggcatgat
tggatgaatcaacagtttggccaaagccttgtactggatggaatcatttatcttcgagcc
actccagagaaatgcttgaataggatatatttacggggaagaaatgaagaacaaggcatt
cctcttgaatatttagagaagcttcactataaacatgagagctggctactgcatagaaca
ctgaaaaccaactttgattttctacaagaaatccctatcttaacactggatattaatgaa
gattttaaagataaacacgacggtctgattgaaaaggtcaaagaatttttgagcactttg
tga

DBGET integrated database retrieval system