KEGG   Ailuropoda melanoleuca (giant panda): 100482382Help
Entry
100482382         CDS       T01329                                 

Gene name
NCOA3
Definition
(RefSeq) nuclear receptor coactivator 3
  KO
K11256  nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01522  Endocrine resistance
aml04915  Estrogen signaling pathway
aml04919  Thyroid hormone signaling pathway
aml05200  Pathways in cancer
aml05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    100482382 (NCOA3)
   04919 Thyroid hormone signaling pathway
    100482382 (NCOA3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100482382 (NCOA3)
   05224 Breast cancer
    100482382 (NCOA3)
  Drug resistance
   01522 Endocrine resistance
    100482382 (NCOA3)
Enzymes [BR:aml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100482382 (NCOA3)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100482382 (NCOA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NCOA_u2 PAS_11 DUF4927 SRC-1 DUF1518 Nuc_rec_co-act PAS PAS_3 PAS_9 PAS_4 HLH PAS_2
Motif
Other DBs
NCBI-GeneID: 100482382
NCBI-ProteinID: XP_011232776
Ensembl: ENSAMEG00000013216
Position
Un
AA seq 1411 aa AA seqDB search
MSGLGENSLDPLAPDSRKRKLPCDTPGQGLTCSGEKWRREQESKYIEELAELISANLSDI
DNFNVKPDKCAILKETVRQIRQIKEQGKAISNDDDVQKADVSSTGQGVIDKDSLGPLLLQ
ALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKSTVN
GVAWTNETQRQKSHTFNCRMLMKTPHDILEDLNTGPEMRQRYETMQCFALSQPRAMMEEG
EDLQSCMICVARRITTGERAFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRR
CIQRFFSLNDGQSWSQKRHYQEAYIHGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTND
RHGFVSTHFLQREQNGYRPNTNPVGPGIRPPAAGCNSSVGGMNMSPNQGLQMLSNRTYGL
ADPSTTGQMSGARYGASNPIASMNPGPGMQSPSSYQSSNYGLNMSSPPHGSPGLGSNQQN
IMISPRNRGSPKMASHQFSPVAGVHSPMGSSSNTGSHSFSSSSLSALQAISEGVGTSLLS
TLSSPGPKLDNSPSMNMSQPNKVNSQDSKSPLGLYCDQNPVESSMCQSNSRDHLGDKESK
ESSIEGSENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTSSPLDSSCKDSSISVTSPSGV
SSSTSGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSTAACVEG
NVKQEQLSPKKKENNALLRYLLDREDPSDTLSKELQPKVEGVDGKMSQCSSSTIPSSSQE
KDSKIKTETNEEGSGDLDNLDAILGDLTSSDFYNNSISTNGSNLGTKQQMFQGTNSLGLR
SPQSVQAIRPPYNRAVSLDSPLSVGSSPPVKNISAFPMLPKQPMLGGNPRMMDSQENYGS
TMGGPNRNVTVNQAPSSGDWGLPNSKASRMEPMSANSMGRPGADYNASLPRPAVGSSMPT
LPLRASSIPGARPVLQQQQQMLQMRPGEIPMGMGVSPYGQAAPSNQPGSWPDGMLSMEQG
PHGAPNRPLLRNSLDDLLGPPSNLEGQSDERALLDQLHTLLSNTDATGLEEIDRALGIPE
LVNQGQALESKQDAFQGQEAALMLDQKATLYGQTYPAQGPPMQGGFNLQGQSPSFNSVMT
QMNQQGGFPLQGMHPRASVLRPRTSSPKQLRLQLQQRLQGQQFLNQSRQALEMKMDSPTA
GSAAVMRPMMQPQVTSQQGFLNAQMVAQRSRELLSHHFRQQRVAMMTQQQQQQQQQPPPP
PPQPQAFSPPPNVTASPSMDGVLAGPVMPQAPPQQFPYPPNYGMGQQPDPAFGRVSSPPN
AMMPSRMGPSQNPMMQHPQTAPMYQSSEIKGWPSGNLARNSSFPQQQFAHQGNPAAYSMV
HMNGSSGPMGQMNMTSMPVAGMPTGPDQKYC
NT seq 4236 nt NT seq  +upstreamnt  +downstreamnt
atgagcggattaggagaaaactccttggatcctctggcccccgattcacgaaaacgcaaa
ttgccatgtgatactccaggacaaggtcttacctgcagtggtgaaaagtggagacgggag
caggagagtaaatatattgaagaattggctgaactgatatctgctaatcttagtgatatt
gacaatttcaatgtcaaaccagataaatgtgcaattttaaaggaaacagtaagacagata
cgtcaaataaaagagcaaggaaaagctatttccaatgatgatgatgttcagaaagctgat
gtatcctctacaggacagggggttattgataaagactccttagggccacttttacttcag
gcattggatggtttcctgtttgtggtgaatcgtgatggaaacattgtatttgtgtcagaa
aatgtcacacagtatctgcagtataagcaagaagacctggttaacacaagtgtctacaat
atcttgcatgaagaagacagaaaggattttcttaaaaacttaccgaaatctacagttaat
ggggttgcctggacaaatgagacccagagacaaaaaagccatacatttaattgccgtatg
ttgatgaaaacacctcatgatattctggaagacttaaacactggtcctgaaatgcgccag
agatacgaaacaatgcaatgctttgccctgtctcagccacgagccatgatggaggaaggg
gaagatttgcagtcctgtatgatctgtgtagcacgccgcattactacaggagaaagagca
tttccctcaaaccctgagagctttattactagacatgatctttcaggaaaagttgtcaac
atagatacaaattcactgagatcctccatgagacctggctttgaggatataatccgaagg
tgtatccagagattttttagtcttaatgatggtcagtcatggtcccagaaacgtcactat
caagaagcttatatccatggccatgcagaaaccccggtgtatcgattctcattggctgat
ggaaccatagtgacagcacaaaccaaaagcaaactcttccgaaatcctgtcacaaatgat
cggcatggctttgtctcaacccactttcttcagagggaacagaatgggtatagaccaaat
acgaatcccgttggaccaggcattagacctccagcagccggatgcaatagttccgtaggt
ggcatgaatatgtcgccaaaccagggtttacagatgctgagcaacaggacctatggcttg
gccgaccccagcaccacagggcagatgagcggagctagatacggggcctccaatcccata
gcatcaatgaaccctgggccaggcatgcagtcaccatcttcctaccagagcagcaactac
ggtctcaacatgagtagccccccacatgggagccctggccttggctccaaccagcagaac
atcatgatttctcctcgtaaccgtgggagtccaaagatggcctcacatcagttttctcct
gttgcaggtgtacactctcccatgggatcttctagtaatactgggagccacagcttttcc
agcagctctctgagtgctcttcaagctatcagtgagggcgtggggacttctcttttatcc
actctgtcttcaccaggccccaaattggataactctcccagtatgaatatgagccagcca
aataaagtgaacagtcaggattccaagagtcctctgggcttgtattgtgaccagaatcca
gtggagagttcgatgtgtcagtcaaatagcagggatcacctcggtgacaaagaaagtaag
gagagcagtattgaagggtcagagaatcagagaggtcctctggaaagcaaaggtcataag
aaattactgcagttacttacctgttcttctgatgaccggggccattcctccttgaccagc
tcccccctggattcaagttgtaaagactcttccattagtgtcaccagcccctctggggtc
tcttcttccacctctggaggagtgtcctccacgtcgaatatgcatggctcactgctgcag
gagaagcaccggattctgcacaagttgctgcagaatgggaattcacccgcagaagtagcc
aagatcaccgcagaagccactgggaaagacaccagtagtacggcagcctgcgtggaagga
aatgtcaagcaggaacaactgagtcccaagaagaaggagaataatgcacttcttcgatat
ctgctggacagggaggatcctagcgatacactctctaaagaactgcagcccaaagtggag
ggagtggacggtaaaatgagtcagtgcagcagctccaccattcctagctcgagtcaagag
aaggactctaaaattaagacagaaacaaatgaagagggatctggagacttggataatcta
gatgctattcttggtgatctgactagttctgacttttacaataattccatatccacaaat
ggtagtaatctgggaaccaagcaacaaatgtttcaaggaactaattctctgggtttgagg
agtccacagtctgtgcaggccattcgtcccccatataaccgagcggtatctctagatagc
cctctttcggttggctcaagtcctccagtaaagaacatcagtgctttccccatgttacca
aagcagcccatgttgggtgggaatccaagaatgatggatagtcaggaaaattatggctca
actatgggtggaccaaacagaaatgtgactgtgaatcaggctccttcctcaggagattgg
ggcttaccaaactcaaaggccagtagaatggagcctatgagtgcaaactccatgggaaga
ccaggagcagattataacgcttccttacccagacctgcggtgggcagctcgatgcccacc
ttgcctctgcgggccagcagcatcccaggggcgagacctgtgttacagcagcagcagcag
atgcttcaaatgcggcctggtgagattcccatgggaatgggggtcagtccgtatggccag
gcagcaccgtctaaccaaccgggttcctggccagatggcatgttgtccatggaacagggc
cctcatggggctccaaataggccacttcttaggaattccctggatgatctccttgggcca
ccttctaacctagaagggcagagtgatgaaagagcgttgttggaccagctgcatactctc
ttgagcaacacagatgccacaggcttggaagaaatcgacagagctctcggcatccctgaa
cttgtaaatcaaggacaagctttggagtccaaacaggatgctttccagggccaagaagcg
gcactaatgctggatcagaaggcgacattatatgggcagacgtacccggcgcaggggcct
cccatgcaaggaggctttaatcttcagggacagtcaccatcttttaactctgtgatgact
cagatgaaccagcaaggcggttttcctctccaaggaatgcacccaagggccagcgtcctg
cgaccccggacgagcagccccaagcagctccggctgcagcttcagcagaggctgcagggc
cagcagtttttgaatcagagccgtcaggcactggagatgaaaatggacagccccactgct
gggagtgctgctgtgatgaggcccatgatgcagccccaggtcacctcccagcagggcttt
ctgaacgcccagatggtggcgcagcgcagcagggagctgctcagtcatcacttccggcag
cagcgggtggccatgatgacgcagcagcagcagcagcagcagcagcagccgccaccgcct
ccgccgcagccccaggccttcagcccgcccccgaacgtgacggcctcccccagcatggat
ggcgttttggcagggccggtgatgccacaggctcctccccagcagtttccatatccacca
aattatggaatgggacagcaaccagatccggcctttggtcgagtgtctagtcctcccaat
gcaatgatgccctcaagaatgggtccctcgcagaatcccatgatgcagcaccctcagacc
gcacccatgtatcagtcctcggaaataaagggctggccgtcaggaaacctagccaggaac
agctccttcccccagcagcaattcgcccaccaggggaaccccgcagcctacagtatggtg
cacatgaatggcagcagcggccccatgggacagatgaacatgacctccatgcccgtggct
ggcatgcccacgggtcccgatcagaaatactgctga

DBGET integrated database retrieval system