KEGG   Ailuropoda melanoleuca (giant panda): 100482761Help
Entry
100482761         CDS       T01329                                 

Gene name
PPID
Definition
(RefSeq) peptidylprolyl isomerase D
  KO
K05864  peptidyl-prolyl isomerase D [EC:5.2.1.8]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04217  Necroptosis
aml04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:aml00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100482761 (PPID)
   04218 Cellular senescence
    100482761 (PPID)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:aml03110]
    100482761 (PPID)
Enzymes [BR:aml01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     100482761 (PPID)
Chaperones and folding catalysts [BR:aml03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    100482761 (PPID)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase TPR_1 TPR_2 TPR_7 TPR_11 TPR_8 TPR_9 TPR_19 TPR_17
Motif
Other DBs
NCBI-GeneID: 100482761
NCBI-ProteinID: XP_002921709
Ensembl: ENSAMEG00000002343
Position
Un
AA seq 370 aa AA seqDB search
MSHPSPQTKPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGP
TTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFYYKHDQEGLLSM
ANAGCNTNGSQFFITTVPTPHLDGKHVLFGQLIKGMGMARILENVEVKGEKPVKLCVIAE
CGELKEGDDWGIFPKDGFGDSHPDFPEDADIDLKDVNKILLITEDVKNIGNTFFKSQNWE
MAIKKYTKVLRYVEGSKAVIEQADRLKLQPVALSCVLNIGACKLKMSDWQGAVNSCLEAL
EIDPSNTKALYRKAQGWQGLKEYDQALADLKKAQEIAPEDKAIQAELLKVKQKIKAQKDK
EKAAYAKMFA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacccatccccgcaaactaagccctccaaccccagtaaccccagagtcttcttt
gatgtggacatcggaggggagcgagttggtcgaattgttttagaattgtttgcagatatt
gtacccaaaactgcagaaaattttcgtgcgttgtgtacgggagaaaagggcattggaccc
accactgggaaacctctccatttcaaaggatgccctttccatcgaattattaagaaattt
atgattcagggtggagacttttcaaatcaaaatgggacaggtggagaaagtatttatggt
gaaaaatttgaagatgaaaatttctattataagcatgatcaggaaggtttattgagcatg
gcaaatgcgggctgcaatacaaatggttctcagttctttatcacaacagtcccgactcct
cacttggatgggaaacatgtgttatttggccaactaattaaaggaatgggtatggcaagg
atactggaaaatgtagaagtgaaaggtgaaaaacctgtcaaattgtgcgttattgcagaa
tgtggagaattgaaggaaggggatgattggggcatattcccaaaagatggctttggtgac
agtcatccagatttccctgaggacgcagatatagatttaaaagatgtaaataaaatttta
ctaataacagaagatgtaaaaaatattggaaatacttttttcaaatcccagaactgggag
atggccattaaaaaatatacaaaagttttaagatatgtggaaggttcaaaggctgttatt
gagcaagcagatagattgaagctgcaacctgtagctttaagctgtgtgctgaatattggt
gcttgtaaactgaagatgtcagattggcagggagcagtcaacagttgtttggaggctctt
gaaatagacccatccaataccaaagcattgtaccgtaaagctcaaggatggcaaggatta
aaagaatacgatcaagcattggctgatctaaagaaagctcaggagatagcaccagaagat
aaagctatccaggcagaattgctgaaagtcaaacaaaagataaaggcacagaaagataaa
gagaaggcagcatatgcaaaaatgtttgcctaa

DBGET integrated database retrieval system