KEGG   Ailuropoda melanoleuca (giant panda): 100482939Help
Entry
100482939         CDS       T01329                                 

Gene name
TGFBR2
Definition
(RefSeq) transforming growth factor beta receptor 2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04060  Cytokine-cytokine receptor interaction
aml04068  FoxO signaling pathway
aml04144  Endocytosis
aml04218  Cellular senescence
aml04350  TGF-beta signaling pathway
aml04380  Osteoclast differentiation
aml04390  Hippo signaling pathway
aml04520  Adherens junction
aml04659  Th17 cell differentiation
aml04926  Relaxin signaling pathway
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml05142  Chagas disease (American trypanosomiasis)
aml05166  HTLV-I infection
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05210  Colorectal cancer
aml05212  Pancreatic cancer
aml05220  Chronic myeloid leukemia
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Module
aml_M00680  TGF-beta signaling
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100482939 (TGFBR2)
   04350 TGF-beta signaling pathway
    100482939 (TGFBR2)
   04390 Hippo signaling pathway
    100482939 (TGFBR2)
   04068 FoxO signaling pathway
    100482939 (TGFBR2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100482939 (TGFBR2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100482939 (TGFBR2)
  Cell growth and death
   04218 Cellular senescence
    100482939 (TGFBR2)
  Cellular community - eukaryotes
   04520 Adherens junction
    100482939 (TGFBR2)
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    100482939 (TGFBR2)
  Endocrine system
   04926 Relaxin signaling pathway
    100482939 (TGFBR2)
  Development
   04380 Osteoclast differentiation
    100482939 (TGFBR2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100482939 (TGFBR2)
   05202 Transcriptional misregulation in cancers
    100482939 (TGFBR2)
   05210 Colorectal cancer
    100482939 (TGFBR2)
   05212 Pancreatic cancer
    100482939 (TGFBR2)
   05225 Hepatocellular carcinoma
    100482939 (TGFBR2)
   05226 Gastric cancer
    100482939 (TGFBR2)
   05220 Chronic myeloid leukemia
    100482939 (TGFBR2)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100482939 (TGFBR2)
  Infectious diseases
   05166 HTLV-I infection
    100482939 (TGFBR2)
   05142 Chagas disease (American trypanosomiasis)
    100482939 (TGFBR2)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100482939 (TGFBR2)
Protein kinases [BR:aml01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   100482939 (TGFBR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ecTbetaR2 Pkinase_Tyr Pkinase Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 100482939
NCBI-ProteinID: XP_019658091
Ensembl: ENSAMEG00000005925
Position
Un
AA seq 587 aa AA seqDB search
MFSPPVWSEDGHREWLSSFPQNPEPAHGSSRAFSAAGCFSCTQREFSSSGNFNNDMMVTD
NNGVIKFPQLCKFCDVRSSTCDNQKSCVSNCSITSICEKPHEVCLAVWRKNDENITLETL
CHDPKDTYHGIVLEDSASPKCIMKEKKVLGETFFMCSCSSDECNDYIIFSEEYATNNPDL
LLVIFQVTGISLLPPLGIAIAVIVTFYCYRVHRQQKLSPSWETSKPRKLMEFSEHLAIIL
EDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFP
YEEYASWKTEKDIFSDINLKHENVLQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRH
VISWEDLRKLGSSLARGIAHLHSDHTLCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGL
SLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSR
CNAVGEVKDYEPPFGSKVREHPCVESMKDNVLRDRGRPEIPSSWLNHQGIQTVCETLTEC
WDHDPEARLTAQCVAERFSELEHLDRLSGRSCSEEKIPEDGSLNTTK
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgttcagcccacccgtttggtcagaggatggacacagagagtggttgagtagctttccg
cagaaccccgagccagctcacggttcatccagagccttctctgctgcaggctgcttctcc
tgtacccagcgtgaattctcctccagtggaaattttaataatgacatgatggtcactgac
aacaatggtgtcatcaaatttccacaattgtgtaaattttgcgatgtgagatcttccacc
tgtgacaatcagaaatcctgcgtgagcaactgcagcattacatccatctgtgagaagcca
catgaagtctgtctggcggtctggagaaagaatgatgagaacataacactggagacgctt
tgccatgaccccaaggacacctaccacggaatcgttctcgaagattctgcttctccaaag
tgtattatgaaggaaaaaaaggtgttgggcgagactttctttatgtgttcctgtagctcc
gacgagtgcaatgactacatcatcttctcggaagaatatgccaccaacaaccctgacctg
ttgttagtcatattccaagtgacaggcatcagcctcctaccaccactgggaatcgccata
gccgtcatcgtcaccttctactgctaccgggttcaccggcagcagaagctgagcccgtcc
tgggagaccagcaagccgcggaagctcatggagttcagcgagcacctggccatcattctg
gaagacgaccgctccgacatcagctctacctgcgccaacaacatcaaccacaacacagag
ctgctgcccattgagctggacaccctggtggggaaaggtcgcttcgccgaggtctacaag
gccaagctgaagcagaacacttcagaacagttcgagaccgtggcggtcaagatcttccct
tatgaggagtacgcctcctggaagacagagaaggacatcttctcagacatcaacctgaag
catgagaacgtcctgcagttcctgacggccgaggagcggaagacagagctgggcaagcag
tactggctgatcacagccttccacgccaagggcaacctacaggagtacctcacgcggcac
gtcatcagctgggaggacctgcgcaagctgggcagctccctcgcccggggcatcgctcac
ctgcacagcgaccataccctgtgcgggaggcccaagatgcccattgtgcacagggacctc
aagagctccaatatcctcgtcaagaacgacctgacctgctgcctgtgtgactttgggctt
tccctgcgcctcgacccgactctgtctgtggatgacctggccaacagtgggcaggtggga
actgcaagatacatggctccagaagtcctagagtccaggatgaatctggagaacgttgaa
tcctttaagcagacggatgtctactccatggctctggtactctgggaaatgacatcgcgc
tgcaatgcggtgggagaagtgaaagattacgagcctccatttggttccaaggtgcgggag
catccttgtgttgagagcatgaaggacaacgtgctgagagaccgagggcgaccagaaatt
cctagctcctggctcaaccaccagggcatccagaccgtgtgcgaaactctgaccgagtgc
tgggaccacgacccggaggcccggctcacggcccagtgcgtggcggagcgcttcagcgaa
ctggagcacctggacaggctctcagggaggagctgctccgaggagaagattcccgaagat
ggctcgctgaacactaccaaatag

DBGET integrated database retrieval system