KEGG   Ailuropoda melanoleuca (giant panda): 100483431Help
Entry
100483431         CDS       T01329                                 

Gene name
SLC4A1
Definition
(RefSeq) solute carrier family 4 member 1 (Diego blood group)
  KO
K06573  solute carrier family 4 (anion exchanger), member 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04966  Collecting duct acid secretion
Brite
KEGG Orthology (KO) [BR:aml00001]
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    100483431 (SLC4A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aml02000]
    100483431 (SLC4A1)
   04147 Exosome [BR:aml04147]
    100483431 (SLC4A1)
   04090 CD molecules [BR:aml04090]
    100483431 (SLC4A1)
Transporters [BR:aml02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   100483431 (SLC4A1)
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100483431 (SLC4A1)
CD molecules [BR:aml04090]
 Proteins
  100483431 (SLC4A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto PTS_EIIA_2
Motif
Other DBs
NCBI-GeneID: 100483431
NCBI-ProteinID: XP_019655760
Ensembl: ENSAMEG00000018346
Position
Un
AA seq 924 aa AA seqDB search
MEDRQEDHEEGLEDALEQEEYEDLDVPVIQEEEPVADHAEPTATDQDTTTDPEATSRAGT
HEVYVELQELVMDEKNQELRWMEAAHWVRMEENLREDGVWSHPHLSYLTFWSLLELQKAF
ANGTVLLDLPETSLAGVANQLLDGFIYEEQIRPEARDLLLRVLLLQHSHAKDLEALGGVK
PTVLTRSGDPSQPLLPQHPSLETQIFCEQGQEGTEGHSPSGILEKIPPDSEASLVLVGRA
EFLERPVLGFVRLQEAVELEAVQLPVPVRFLFVLLGPEAPNIDYTQLGRAAATLMSEKVF
RMDAYLAQSKAELVCNLEGFLDCSLVLPPCEAPSEQALLSLVPVQKELLRRRYLRSPAKP
EPLFYKGLDLYGGPGTPDGPDDPLQRTGLLFGGLVRDIRRRYPRYLSDITDACSPQVLAA
VIFIYFAALSPAITFGGLLGEKTQNQMGVSELLISTAAQGILFSLLGAQPLLVVGFSGPL
LVFEEAFFSFCTSHNLEYIVGRVWIGFWLVLLVVLIVAFEGSFLVRFISRYTQEIFSFLI
SLIFIYETFVKLIKIFQDHPLQKHYDHNVTLVPKPQAPLPNTALLSLVLMAGTFFFAMLL
RKFKNSSYFPGVLRRIIGDFGVPISILIMVMVDFFIEDTYTQKLSVPKGLSVSNSSARGW
VIHPLGLYSPFPIWMMFASALPALLVFILIFLESQITTLIISKPERKLVKGSGFHLDLLL
VIGMGGVAALFGMPWLSATTVRSVTHANALTVMGKASAPGASAQIQEVKEQRISGLLVAV
LVGVSILMGPILSRIPLAVLFGIFLYMGVTSLSGIQLFDRVLLLFKPSKYHPDVPYVKRV
RTWRMHLFTVIQIVCLAGLWAVKTFPTTSLALPFVLILTVPLRRLLLPLIFQKLELQCLD
ADDAKPTFDEEEGQDAYDEVTMPV
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atggaggaccggcaggaggatcacgaagaggggctggaggacgctctagaacaggaggaa
tatgaagacctggatgtccccgtgattcaggaggaagagccagtagctgaccacgctgag
ccgacagccacagaccaagacacgaccacagacccagaagccacatcgcgagctggcacc
cacgaggtgtacgtggagctgcaggaactggtgatggatgagaagaaccaggagctgcgg
tggatggaggcagcacactgggtgcggatggaggagaacctcagggaggatggggtctgg
agccacccgcacctgtcctacctcaccttctggagcctcttggagctgcagaaagccttt
gccaacgggaccgtcctcctggatctgccagagacctccctggcgggagtggccaaccag
ctgctggatgggtttatctacgaggagcagatccggcctgaggcccgggacctgctgctc
cgggtcctactgctgcagcacagccatgccaaagacctggaggccctggggggtgtgaag
cccacggttctgacgcgttctggggacccctcacagcctctgctcccccagcacccctca
ttagagacgcagatcttctgtgaacagggacaggagggcacagaagggcattcaccatct
ggaattctggagaagattcccccagattcggaggcctccctggtgctcgtgggccgagca
gagttcctcgagcgcccggtgctgggctttgtgcggctgcaggaggccgtggagctggag
gccgttcagctcccggtgcccgtgcgcttcctctttgtgttgctgggacccgaggccccc
aacatcgattacacccagcttggtcgggctgcggccaccctcatgtcagagaaggtgttc
cgcatggatgcctacctggcccagagtaaggcggagctggtctgcaacctggagggcttc
ctggactgcagcctggtgctgcctccctgcgaggccccctccgagcaggccctgctcagt
ctggtgcccgtgcagaaggagctgctgcggaggcgatacctgcgaagccctgccaagcct
gagcccctcttctacaagggcctagatttgtatgggggtccagggacccctgatgggcca
gacgaccctctgcagcggacaggcctgctctttgggggtctggtgcgtgacatccggcgc
cgctacccccgctacttgagcgacatcacggacgcgtgcagcccccaggtcctggccgct
gtcatcttcatctactttgctgccttgtcacctgccatcaccttcggcggcctcctggga
gaaaagacccagaaccagatgggggtgtcggagctgctcatctccaccgcggcgcagggc
attctcttctccctgttgggggctcagcccctgcttgtggttggcttctcaggacccctg
ctcgtgtttgaagaagcctttttctcgttctgcactagccacaacctggagtacatcgtg
ggccgcgtgtggatcggcttctggctcgtcctgttggtcgtgctcatagtggccttcgag
ggcagtttcctggtccgcttcatctcccgctacacccaagagatcttctccttcctcatc
tctctcatcttcatctatgagactttcgtcaagctgatcaagatcttccaggaccaccca
ctgcagaagcattatgaccacaacgtgacactggtgcccaaacctcaggctcccctgccc
aacacagccctcctctcccttgtgctcatggctggcaccttcttcttcgccatgctgctg
cgaaagttcaagaacagctcctacttccctggcgtgctgcgacggatcattggggacttc
ggggtccccatctccattctgatcatggtcatggtggatttcttcatcgaggacacctac
acccagaaactcagcgtgcctaaaggcctctcagtgtccaactcctcagcccggggctgg
gtcatccacccactgggcttgtattcacctttccccatctggatgatgtttgcctccgcc
ctgcctgccctgctggtcttcatcctcatcttccttgagtctcagatcaccacgctgatt
atcagcaaaccagagcgcaagttggtcaagggctctggcttccacctggacctgctgctg
gtcattggcatgggcggtgtggctgccctctttgggatgccctggctcagtgccaccacc
gtccgttctgtcacccacgccaatgcgctcactgtcatgggcaaggccagcgccccaggg
gcttccgcccagattcaggaggtcaaggagcagcggatcagcgggctcctggttgctgtg
ctcgtgggcgtgtccatcctcatggggcccatcctgtcccgcatccccctggctgtgctg
ttcggcatcttcctctacatgggggtcacgtccctcagcggcatccagctctttgaccgc
gtcttgctcctgttcaagccgtccaagtaccaccccgatgtgccctacgtcaagcgggtg
aggacctggcggatgcacttgttcacggtcatccagatcgtctgcctggcagggctgtgg
gccgtgaagaccttccccaccacctcgctggccctgcccttcgtcctcatcctcacggtg
cctctgcgccgcctcctgctgccgctcatcttccagaagctggagctccagtgtctggat
gctgacgacgccaagccgaccttcgatgaagaggagggtcaggatgcgtacgacgaggtg
accatgcccgtgtga

DBGET integrated database retrieval system