KEGG   Ailuropoda melanoleuca (giant panda): 100483500Help
Entry
100483500         CDS       T01329                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00561  Glycerolipid metabolism
aml01100  Metabolic pathways
aml04714  Thermogenesis
aml04723  Retrograde endocannabinoid signaling
aml04923  Regulation of lipolysis in adipocytes
Module
aml_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100483500 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100483500 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100483500 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    100483500 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:aml01002]
    100483500 (MGLL)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100483500 (MGLL)
Peptidases [BR:aml01002]
 Serine Peptidases
  Family S33
   100483500 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Lipase_3 Abhydrolase_3 DLH LIDHydrolase Thioesterase Abhydrolase_5 PGAP1 Peptidase_S9 BAAT_C DUF1057 Abhydrolase_2 DUF1350 DUF2974 Ser_hydrolase
Motif
Other DBs
NCBI-GeneID: 100483500
NCBI-ProteinID: XP_002917697
Ensembl: ENSAMEG00000015086
Position
Un
AA seq 346 aa AA seqDB search
MLPCDGRHEGTALICLALIPRAVVVVECKSQDTMETGLEAPFRMPEESSPRRTPQSVPYQ
DLPHLVNADGQYLFCRFWKPTGTPRALIFVSHGAGEHCGRYDELAQMLAGLGLLVFAHDH
VGHGQSEGERMVVSDFHVFIRDVLQHVDTMQKDYPGLPVFLLGHSMGGAIAILTAAERPS
HFSGMVLISPLVLANPESATTFKVFAAKVLNLVLPNMSLGPIDSSVLSRNKTEVDLYNSD
PLICHAGLKVCFGNQLLNAVTRVERALPKLTLPFLLLQGSADRLCDSKGAYLLMESAKSQ
DKTLKIYEGAYHVLHKELPEVTNSVFREINMWVSQRTGAAGTGSPP
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgctgccctgtgacggccgacatgagggaacagcccttatctgcctggctctgatcccc
cgtgctgtcgtggttgtggaatgcaaaagccaggacacgatggaaacaggacttgaagct
cctttcagaatgccggaggaaagttctcccaggcggaccccgcagagcgttccgtaccag
gacctccctcacctggtcaatgcggacggacagtacctgttctgcaggttctggaaaccg
acgggcacacccagggccctcatctttgtgtcccatggagccggggaacactgcggtcgt
tatgacgagctggctcagatgctggcggggctggggctgctggtgttcgcccatgaccat
gttggccatggacagagcgaaggagagaggatggtagtgtctgacttccacgttttcatc
agggacgtgttacagcacgtggataccatgcagaaagactacccagggcttcctgtcttc
cttctgggccactccatgggaggtgccatcgccatcctcacggccgcggagaggccaagc
cacttctccggcatggtcctcatttcgcctttggttcttgccaatcctgagtctgcaaca
actttcaaggtctttgctgcgaaagttctcaaccttgtcctgccaaacatgtccctgggc
ccaattgactccagcgtgctctctcggaataagacagaggtggacctttataactcagac
ccactcatctgccacgcaggtctgaaggtgtgcttcggcaaccagctgctcaacgcggtg
acgcgggtggagcgggccctccccaagctgaccttgcccttcctgctgctccagggctct
gccgaccgcctttgtgacagcaaaggggcctacctgctcatggagtctgccaagagccag
gacaagacactcaagatttacgaaggtgcctaccacgttctccacaaagagcttcctgaa
gtaaccaactcggtcttccgtgaaataaacatgtgggtctcccaaaggacaggggcggca
ggaacagggtccccaccctga

DBGET integrated database retrieval system