KEGG   Ailuropoda melanoleuca (giant panda): 100483558Help
Entry
100483558         CDS       T01329                                 

Gene name
HSPA1A
Definition
(RefSeq) heat shock protein family A (Hsp70) member 1A
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml03040  Spliceosome
aml04010  MAPK signaling pathway
aml04141  Protein processing in endoplasmic reticulum
aml04144  Endocytosis
aml04213  Longevity regulating pathway - multiple species
aml04612  Antigen processing and presentation
aml04915  Estrogen signaling pathway
aml05134  Legionellosis
aml05145  Toxoplasmosis
aml05162  Measles
Brite
KEGG Orthology (KO) [BR:aml00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100483558 (HSPA1A)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100483558 (HSPA1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100483558 (HSPA1A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100483558 (HSPA1A)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100483558 (HSPA1A)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100483558 (HSPA1A)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100483558 (HSPA1A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100483558 (HSPA1A)
  09172 Infectious disease: viral
   05162 Measles
    100483558 (HSPA1A)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100483558 (HSPA1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aml01009]
    100483558 (HSPA1A)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:aml03041]
    100483558 (HSPA1A)
   03009 Ribosome biogenesis [BR:aml03009]
    100483558 (HSPA1A)
   03110 Chaperones and folding catalysts [BR:aml03110]
    100483558 (HSPA1A)
   04131 Membrane trafficking [BR:aml04131]
    100483558 (HSPA1A)
   03051 Proteasome [BR:aml03051]
    100483558 (HSPA1A)
   03029 Mitochondrial biogenesis [BR:aml03029]
    100483558 (HSPA1A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aml04147]
    100483558 (HSPA1A)
Protein phosphatases and associated proteins [BR:aml01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100483558 (HSPA1A)
Spliceosome [BR:aml03041]
 Complex B
  Other components
   Prp19 complex
    100483558 (HSPA1A)
 Complex C
   Prp19-CDC5 complex
    100483558 (HSPA1A)
Ribosome biogenesis [BR:aml03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100483558 (HSPA1A)
Chaperones and folding catalysts [BR:aml03110]
 Heat shock proteins
  HSP70 / DNAK
   100483558 (HSPA1A)
Membrane trafficking [BR:aml04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100483558 (HSPA1A)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100483558 (HSPA1A)
Proteasome [BR:aml03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100483558 (HSPA1A)
Mitochondrial biogenesis [BR:aml03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100483558 (HSPA1A)
Exosome [BR:aml04147]
 Exosomal proteins
  Proteins found in most exosomes
   100483558 (HSPA1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Radial_spoke_3
Motif
Other DBs
NCBI-GeneID: 100483558
NCBI-ProteinID: XP_002931115
Ensembl: ENSAMEG00000018827
UniProt: D2I7H0
Position
Un
AA seq 641 aa AA seqDB search
MAKTAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS
SMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNH
FVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN
KSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI
PTKQTQIFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDI
DANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKN
ALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELE
QVCNPIITRLYQGAGGPGAGGFGAQAPKGGSGSGPTIEEVD
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaactgcggccatcggcatcgacctgggcaccacctactcctgcgtgggggtg
ttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcaccacccccagc
tacgtggccttcaccgacaccgagcggctcatcggggatgcggccaagaaccaggtggcg
ctgaacccgcagaacacggtgttcgacgcgaagcggctgatcggccgcaagttcggcgac
ccggtggtgcagtcggacatgaagcactggcctttccaggtgatcaacgacggggataag
cccaaggtgcaggtgagctacaagggggagaccaaggcgttctaccccgaggagatctcg
tccatggtgctgaccaagatgaaggagatcgccgaggcgtacctgggctacccggtgacc
aacgcggtgatcaccgtgccggcctacttcaacgactcgcagcgccaggccaccaaggac
gcgggggtgatcgcggggctgaacgtgctgaggatcatcaacgagcccacggccgccgcc
atcgcctacggcctggacaggaccggcaagggggagcgtaacgtgctcatctttgacctg
ggcggcggcaccttcgacgtgtccatcctgacgatcgacgacggcatcttcgaggtgaag
gccacggccggggacacccacctgggaggcgaggactttgataacaggctggtgaaccac
ttcgtggaggagttcaagaggaagcacaagaaggacatcagccagaacaagcgagccgtg
aggcggctgcgcaccgcctgcgagagggccaagaggaccctgtcgtccagcacgcaggcc
agcctggagatcgactccctgttcgagggcatcgacttctacacgtccatcaccagggcg
cggttcgaggagctgtgctccgacctgttccggagcaccctggagccggtggagaaggcg
ctgcgcgacgccaagctggacaaggcccagatccacgacctggtcctggtggggggctcc
acccgcatccccaaggtgcagaagctgctgcaagacttcttcaacgggcgcgacctcaac
aagagcatcaatccggacgaggcggtggcctacggggcggcggtgcaggcggccatcctg
atgggggacaagtctgagaacgtgcaggacctgctgctgctggacgtggctccgctgtcg
ctggggctggagacggccgggggcgtgatgacggccctgatcaagcgcaactccaccatc
cccacgaagcagacgcagatcttcaccacctactcggacaaccagcccggcgtgctgatc
caggtgtacgagggcgagagggccatgacgcgggacaacaacctgctggggcgcttcgag
ctgagtggcatcccccccgccccccggggagtgccccagatcgaggtgaccttcgacatc
gatgccaacggcatcctgaacgtcacggccacggacaagagcacgggcaaggccaacaag
atcaccatcaccaacgacaagggccgcctgagcaaggaggagatcgagcgcatggtgcag
gaggccgagaagtacaaagccgaggacgaggtgcagcgcgagagggtgtctgccaagaac
gccctggagtcctatgccttcaacatgaagagtgccgtggaggatgagggtctcaagggg
aagatcagcgaggccgacaagaagaaggtgctggacaagtgccaggaggtgatttcctgg
ctggatgccaacaccttggccgagaaggatgagtttgagcacaagaggaaggagctggag
caggtgtgtaaccccatcatcaccagactgtaccagggggcgggtggccctggggctggc
ggctttggggctcaggcccccaaagggggctctgggtctggccccaccatcgaggaggtg
gattag

DBGET integrated database retrieval system