KEGG   Ailuropoda melanoleuca (giant panda): 100483652Help
Entry
100483652         CDS       T01329                                 

Gene name
PDK1
Definition
(RefSeq) pyruvate dehydrogenase kinase 1
  KO
K12077  pyruvate dehydrogenase kinase isoform 1 [EC:2.7.11.2]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04066  HIF-1 signaling pathway
aml04360  Axon guidance
aml05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100483652 (PDK1)
 Organismal Systems
  Development
   04360 Axon guidance
    100483652 (PDK1)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100483652 (PDK1)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     100483652 (PDK1)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   100483652 (PDK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BCDHK_Adom3 HATPase_c HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 100483652
NCBI-ProteinID: XP_019649332
Ensembl: ENSAMEG00000001727
Position
Un
AA seq 378 aa AA seqDB search
MKQFLDFGSMNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYFQSL
QELLEFKDKSAEDAKTIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQ
YFLDRFYMSRISIRMLLNQHSLLFGGKGKGSPAHRKHIGSINPNCNVVEVIKDGYENARR
LCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHADKGVY
PPIQVHITLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYG
LPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTESIERLPVYNKAAWKHYNTNHEAD
DWCVPSREPKDMTTFRSA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagttcctggacttcggatctatgaatgcttgtgaaaaaacctcatttatgttt
ctgcggcaagagctgcctgttagattggcaaatataatgaaagaaataagtcttctccca
gataatcttctcaggactccatcagttcaattggtacaaagctggtatttccagagtctt
caggagcttcttgaatttaaagacaaaagtgccgaagatgctaaaactatttatgacttt
acagatactgtgattcggatcaggaaccgacacaacgatgtcattcccacgatggcccag
ggtgtgattgaatataaggagagcttcggggtggaccctgtcaccagccagaatgttcag
tactttttggatcgtttctacatgagtcgcatttcaattagaatgttactcaatcagcac
tctttattgtttggtggaaaaggcaaaggaagcccagctcatcgaaaacacattggaagc
ataaatccaaactgcaatgtagttgaagttattaaagatggctatgaaaatgctaggcgt
ctgtgtgatttgtattatattaactctcctgaactagaacttgaagaactaaatgcaaaa
tcaccaggacagccaatacaagtggtttatgtaccatcccatctctatcacatggtgttt
gaacttttcaagaatgcaatgagagcaacgatggaacaccatgctgacaaaggtgtttac
cctcctattcaagtccacatcacactgggtaatgaggatttgactgtgaagatgagtgac
cgaggaggtggggttcctttgaggaaaattgacagactcttcaactacatgtactcaact
gcaccccggcctcgtgttgagacgtcccgagcagtgcctctggctggttttggttatgga
ttgcccatatcacgtctttatgcccaatatttccaaggagacctaaagctatattctcta
gaaggttatgggacagatgcggtcatctacattaaggctctgtcaacggaatcgatagag
agactcccagtgtataacaaagctgcctggaagcattacaacaccaaccatgaggctgat
gactggtgtgtccccagcagggaaccaaaagacatgacaacgtttcgcagtgcctag

DBGET integrated database retrieval system