KEGG   Ailuropoda melanoleuca (giant panda): 100484553Help
Entry
100484553         CDS       T01329                                 

Gene name
GNB2
Definition
(RefSeq) G protein subunit beta 2
  KO
K04537  guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04014  Ras signaling pathway
aml04062  Chemokine signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04371  Apelin signaling pathway
aml04713  Circadian entrainment
aml04723  Retrograde endocannabinoid signaling
aml04724  Glutamatergic synapse
aml04725  Cholinergic synapse
aml04726  Serotonergic synapse
aml04727  GABAergic synapse
aml04728  Dopaminergic synapse
aml04926  Relaxin signaling pathway
aml05032  Morphine addiction
aml05034  Alcoholism
aml05167  Kaposi's sarcoma-associated herpesvirus infection
aml05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100484553 (GNB2)
   04371 Apelin signaling pathway
    100484553 (GNB2)
   04151 PI3K-Akt signaling pathway
    100484553 (GNB2)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    100484553 (GNB2)
  Endocrine system
   04926 Relaxin signaling pathway
    100484553 (GNB2)
  Nervous system
   04724 Glutamatergic synapse
    100484553 (GNB2)
   04727 GABAergic synapse
    100484553 (GNB2)
   04725 Cholinergic synapse
    100484553 (GNB2)
   04728 Dopaminergic synapse
    100484553 (GNB2)
   04726 Serotonergic synapse
    100484553 (GNB2)
   04723 Retrograde endocannabinoid signaling
    100484553 (GNB2)
  Environmental adaptation
   04713 Circadian entrainment
    100484553 (GNB2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100484553 (GNB2)
  Substance dependence
   05032 Morphine addiction
    100484553 (GNB2)
   05034 Alcoholism
    100484553 (GNB2)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100484553 (GNB2)
Exosome [BR:aml04147]
 Exosomal proteins
  Proteins found in most exosomes
   100484553 (GNB2)
GTP-binding proteins [BR:aml04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    100484553 (GNB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 WD40_like eIF2A CALM_bind Cytochrom_D1
Motif
Other DBs
NCBI-GeneID: 100484553
NCBI-ProteinID: XP_002927346
Ensembl: ENSAMEG00000014766
UniProt: D2HX06
Position
Un
AA seq 340 aa AA seqDB search
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYA
MHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNI
CSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGF
AGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYA
FTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAM
KGDRAGVLAGHDNRVSCLGVTDDGMAGGPGSWDSFLKIWN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagctggagcaactgagacaggaggctgagcagctccggaaccagatccgggat
gcccgaaaagcatgtggggattcaacactgacccagatcacagctgggctggacccagtg
gggagaatccagatgaggacacggaggaccctccgtgggcacctggcaaaaatctatgcc
atgcactgggggacagactcaaggctgctggtcagtgcctcccaggatgggaagctcatc
atttgggacagctataccaccaacaaggtccatgccatccctctgcgctcctcctgggtc
atgacctgtgcctatgcgccctcagggaactttgtggcctgtggagggctggacaacatc
tgctccatctacagcctcaagacccgcgagggcaatgtccgggtcagccgggaattgcct
ggccacaccgggtacctgtcgtgctgccgcttcctggatgacaaccaaatcatcaccagc
tccggggacaccacctgtgccctgtgggacattgagacaggccagcagacagtgggtttt
gctgggcacagtggagatgtgatgtccctgtcactggcccccgatggccgcacctttgtg
tctggtgcctgtgacgcctccatcaagctgtgggacgtgcgggattctatgtgccgacag
accttcatcggccacgagtcagacatcaatgccgtggcgttcttccccaacggctacgcc
ttcaccactggctccgatgatgccacgtgccgcctcttcgacctgcgggctgaccaggag
ctgctcatgtactcccacgacaacatcatctgcggcatcacctctgttgccttctcccgc
agcggccggctgctgctcgccggctacgacgacttcaactgcaacatctgggacgccatg
aagggcgaccgtgcaggtgtcctcgccggccacgacaaccgtgtgagctgcctcggggtc
accgatgatggcatggctgggggcccaggctcctgggactccttcctcaagatctggaac
taa

DBGET integrated database retrieval system