KEGG   Ailuropoda melanoleuca (giant panda): 100484579Help
Entry
100484579         CDS       T01329                                 

Gene name
FOXL1
Definition
(RefSeq) forkhead box L1
  KO
K09405  forkhead box protein L
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
KEGG Orthology (KO) [BR:aml00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100484579 (FOXL1)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    100484579 (FOXL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Forkhead
Motif
Other DBs
NCBI-GeneID: 100484579
NCBI-ProteinID: XP_002913428
Ensembl: ENSAMEG00000019188
UniProt: D2GWM9
Position
Un
AA seq 346 aa AA seqDB search
MSHLFGPRLPALAASPMLYLYGPERPGLPLAFAPAAALAASGRAEPPQKPPYSYIALIAM
AIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNDCFVKVPREKGRPGKG
SYWTLDPRCLDMFENGNYRRRKRKPKPGPGPPEAKRVCAETHERGGSEAQPRAGSGAGRC
GPATPRQEGEPARPSPLRDGSSPPAPLRWPGPASPEEDAGDAVQGAAALAIGQPERTVDG
PGSPQRPASQGSPKSSDKSKSFSIDSILAGRQGQKPAGGDELFGSAKPGPGSCLGASLLA
TTSSLRPPFNASLMLDPHVQGGFYQLGIPFLSYFPLQLPDTVLHFQ
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgagccacctcttcggtcccaggctgcctgctctggccgcctcacccatgctctatctg
tacggccccgagagacccgggctgcctctggccttcgcccccgcggccgctctggccgcg
tcgggccgggcggagccgccccagaagccgccctacagctacatcgcgctcatagccatg
gcgatccaggacgcgcccgagcagagggtcacgctgaacggcatctaccagttcatcatg
gaccgcttccccttctaccacgacaaccggcagggctggcagaacagcatccgccacaac
ctctcgctcaacgactgcttcgtcaaggtgccccgcgagaaggggcggccaggcaagggc
agctactggaccctggaccctcgctgcctggatatgttcgagaatggcaactaccggcgc
cggaagaggaagcccaagccaggcccagggccccccgaggccaagcgggtctgcgcggag
acgcacgagcgcggcggctcggaggcgcagccccgggcgggaagcggggcagggcgttgt
ggccccgcgaccccccgccaggagggagagcccgcgcgcccctcgcccctccgggacggc
tcctctccacccgcgcccctccgctggcctgggcctgcgtctccggaggaggacgctggc
gacgctgtccagggcgcagcggccttggccataggccagccagagcgcacggtggatggc
ccggggtcccctcaacgccctgcttcccagggctctccgaagagctccgacaagtccaag
agcttcagcatagacagcatcctggccgggcggcagggtcagaagcccgctggaggggac
gagcttttcgggagcgccaagccggggccgggaagctgtctgggtgcctcgcttctggcc
accacctcaagcctccgaccgcctttcaacgcttccctgatgcttgacccgcatgtccaa
ggaggcttttaccagctcgggatccctttcctctcctatttccctctgcagcttcccgac
acggtgcttcacttccagtaa

DBGET integrated database retrieval system