KEGG   Ailuropoda melanoleuca (giant panda): 105234337
Entry
105234337         CDS       T01329                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
KEGG Orthology (KO) [BR:aml00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    105234337 (AHRR)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    105234337 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 105234337
NCBI-ProteinID: XP_034513014
Ensembl: ENSAMEG00000008443
Position
3
AA seq 725 aa
MMIPPGECMYAGRKRRKPIQKQRPATGAEKSNPSKRHRDRLNAELDHLASLLPLPPDIVS
KLDKLSVLRLSVSYLRVKSFFQAVQKCPRPPAASAPSPAPSAEDCGLSGRSVVLEGRLLL
ESLDGFALVVSAEGMIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMD
PPQVVFGQPLHSETEDAVLGRLLRAQEGGAGSPTDFSAFLTRCFVCRVRCLLDSTSGFLT
MQFQGKLKFLFGQKRKTPSGTVQPPRLSLFCIVVPVLLPSVAEMKMKSAFLRVKHRVDVS
ASMDAKARVAASQCDPEFHGKPSYFTGRNNGENIPVLRTQADAGRWARVPARAPCLCLRN
GPDLISDPEGASGDRGGDEHGRVPGISSAARGRREIHAHSCCFESPGPLKHVSWMTGRQG
QDGGSKLKLEPSRSDPFSMRAVSLGSCAPCPGVQGAVNTSGVTAFRNPPSCHPGSNSPSA
YASCTSRALRDSDQGQAHPPPSCPFPRGSLDSGLPQPRGQRLTAAGYSIEDTKFRGGPVP
SGALCNPILSLDVPIKMENDSGSEDATGGYSLSPHQVWLGASGTAKRQLVTFPTRMHLKT
ELEAKHHLYAPHLEHSLLEAHPSVRAPLRPGRELAPFHPAHCACLERGHGLPEPEPPHHF
CAQGHQPPTLGCDCRAPGTAPIVKREPLDSPPWASHSQGGVPGMFPKSAMATLMPPKAPE
CAFLP
NT seq 2178 nt   +upstreamnt  +downstreamnt
atgatgatcccaccaggggagtgcatgtatgctggaaggaaaagaaggaagcccattcag
aaacagaggcctgccacgggggctgagaagtcaaacccttccaagcggcaccgggaccgt
ctcaacgccgagctggaccacctggccagcctgctgcctcttcctccggacatcgtgtct
aagctagacaagctttctgttctgcgtctcagtgtcagctacctcagagtgaagagcttc
ttccaagccgtgcagaagtgtccacggccgccggcggccagtgccccttcacctgccccc
tcagccgaagactgcggtctgagcggaagatccgtggtgctggagggaaggctgctgctg
gagtctctcgatggctttgccctggtcgtgagtgcggaaggcatgatattttatgcttca
gcaacaatcgtggactatctgggcttccaccagaccgatgtgatgcaccaaaacatttac
gactacatccatgtggacgaccgccaggacttctgccggcagctccactgggccatggac
cctccccaggtggtgtttgggcagcccctgcactcagagacagaggacgccgtcctgggg
agactgctgcgcgcgcaggagggaggcgcgggctcgcccacggacttctcggccttcctg
acgcgctgcttcgtgtgccgcgtgcgctgcctgctggacagcacctcgggctttctgacg
atgcagtttcaaggaaaactaaaattcctgtttggacagaagaggaaaacgccgtcgggg
acagtccagccccctcggctctcactgttctgcatcgtggtgcctgtcctcctaccttcc
gtggcggagatgaaaatgaagagtgcgtttttgagggtgaagcacagggtggacgtctca
gcctcaatggatgcaaaagcaagagtggccgcgagtcagtgcgatccagaattccatggg
aaacccagttacttcacagggaggaacaacggagaaaacattccagtgctcaggacacaa
gcggacgcgggacgctgggcccgggttccagccagagccccatgcctgtgcctcagaaat
ggccccgacctcatttctgaccctgaaggggcctcaggggacaggggaggagatgagcat
ggcagggtgcccggcatctcctcagcagccagggggcggagagaaatacatgcacacagt
tgctgcttcgagtcacctggacccctgaagcacgtgagctggatgacggggcgacagggc
caggacgggggcagcaagctgaagctggagcccagcaggagtgacccgttctccatgcgt
gctgtgtcccttggttcctgcgcgccctgcccaggcgttcagggcgccgtcaacaccagt
ggggtaactgctttcaggaatccccccagctgtcacccaggaagcaattctcccagcgcc
tatgccagctgcaccagcagagctttgcgggacagcgatcagggccaggcgcaccctcca
cccagctgccccttcccccgggggagcctggacagtgggctccctcagcccagagggcaa
cgtctcacagcggcgggctattccatcgaggacaccaagtttcgaggagggccagtgccc
tcgggagctctatgcaaccccatcttgtcacttgatgtgcccatcaagatggagaatgac
tctgggtctgaggatgccacaggtggctactccctgtccccgcaccaggtgtggctggga
gccagcggtacagccaagagacagctggtcactttccctaccaggatgcacctgaaaaca
gagctggaagccaagcaccacctgtacgctccgcacctggagcacagcttgctggaggct
cacccgagcgtcagggctccgctcagacctggcagggagctggcccccttccaccccgca
cactgtgcctgcctggagcgtgggcatggccttcctgagccagagcctccccaccacttc
tgtgcacaggggcaccagccccccacactgggctgtgactgccgagctccggggactgcg
cccatcgtcaaacgggagcccctggactccccgccatgggccagtcacagccagggcggg
gtgcccggaatgttccccaaaagtgccatggcaacgctgatgcctcccaaagcccctgag
tgtgctttcctgccataa

DBGET integrated database retrieval system