KEGG   Ailuropoda melanoleuca (giant panda): 105234922
Entry
105234922         CDS       T01329                                 

Definition
(RefSeq) M1-specific T cell receptor alpha chain isoform X1
  KO
K10784  T cell receptor alpha chain V region
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04064  NF-kappa B signaling pathway
aml04514  Cell adhesion molecules
aml04612  Antigen processing and presentation
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04672  Intestinal immune network for IgA production
aml04940  Type I diabetes mellitus
aml05135  Yersinia infection
aml05142  Chagas disease
aml05144  Malaria
aml05150  Staphylococcus aureus infection
aml05162  Measles
aml05166  Human T-cell leukemia virus 1 infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05202  Transcriptional misregulation in cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
aml05310  Asthma
aml05320  Autoimmune thyroid disease
aml05321  Inflammatory bowel disease
aml05322  Systemic lupus erythematosus
aml05323  Rheumatoid arthritis
aml05330  Allograft rejection
aml05332  Graft-versus-host disease
aml05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    105234922
   04015 Rap1 signaling pathway
    105234922
   04064 NF-kappa B signaling pathway
    105234922
   04020 Calcium signaling pathway
    105234922
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    105234922
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    105234922
   04660 T cell receptor signaling pathway
    105234922
   04658 Th1 and Th2 cell differentiation
    105234922
   04659 Th17 cell differentiation
    105234922
   04672 Intestinal immune network for IgA production
    105234922
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    105234922
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105234922
  09163 Immune disease
   05310 Asthma
    105234922
   05322 Systemic lupus erythematosus
    105234922
   05323 Rheumatoid arthritis
    105234922
   05320 Autoimmune thyroid disease
    105234922
   05321 Inflammatory bowel disease
    105234922
   05330 Allograft rejection
    105234922
   05332 Graft-versus-host disease
    105234922
  09166 Cardiovascular disease
   05416 Viral myocarditis
    105234922
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    105234922
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    105234922
   05150 Staphylococcus aureus infection
    105234922
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105234922
   05170 Human immunodeficiency virus 1 infection
    105234922
   05162 Measles
    105234922
   05169 Epstein-Barr virus infection
    105234922
  09174 Infectious disease: parasitic
   05144 Malaria
    105234922
   05142 Chagas disease
    105234922
SSDB
Motif
Pfam: V-set Ig_3 I-set Ig_2 ig
Other DBs
NCBI-GeneID: 105234922
NCBI-ProteinID: XP_034504603
Ensembl: ENSAMEG00000008343
Position
20
AA seq 317 aa
MGCFLHRLTSRLQKLPLAAREYAGGRPQGAMMCGFLHGKKEEHYLGDTAEMKCSPGFLTV
ILLMLGQTHGDSVTQTEGQVTLLEEASLTMNCTYSTIGSPTLFWYVQYPGEGLKLLLKSS
RDQEKKSNNGFEATLDSKSKSFHLEKGSVQGSDAAMYYCAMSDTGSGKVLHFGPGTQVIV
TPHITDPDPAVYQLKSPKSSKTSVCLFTDFDSEKKMPQSQEGTVIMSNGTVLDMRVMDSK
SNGVLAWSNSTDFKCNSTFNEKFYSSSDFSCNATLIEKSFETDMNLNAHNLLVMGLRVLL
LKVAGFNLFVTLRLWSR
NT seq 954 nt   +upstreamnt  +downstreamnt
atgggttgctttctgcacaggctcactagtcgcttacagaagctccctcttgctgcccgc
gagtacgccggtggcaggccgcagggtgcgatgatgtgtgggtttcttcatggtaagaaa
gaagaacattatttaggtgacactgcagagatgaagtgttctccaggcttcctgactgtg
atactcttaatgcttggacaaacccatggagactcagtgacccagacggaaggccaagtg
accctcttagaagaggcttctttgactatgaactgtacttattcaacaatagggtccccc
actcttttctggtatgtccagtatcctggtgaaggtctaaagctcctcctgaaatcctcg
agggaccaggagaagaaaagcaacaacggttttgaagccaccttggacagcaaatccaaa
tccttccacctggagaaaggctcagtgcaagggtcagatgcagctatgtattactgtgcc
atgagtgatacaggctcggggaaggtgctgcattttgggcccggcactcaagtgattgtc
acaccacatatcacggaccctgatcccgccgtgtaccaactgaaaagccctaaatccagt
aagacgtctgtctgcctgttcaccgattttgattctgaaaaaaaaatgccacaatcccag
gagggcacagtaatcatgtcgaatggaactgtgctggacatgagggtgatggattccaag
agcaacggggtcctggcctggagcaacagcacggattttaaatgcaacagtaccttcaac
gagaaattctactccagctcagacttttcctgtaatgccactttgatagagaaaagcttt
gaaacagatatgaacctaaacgcccacaacctgctagtgatggggctgcgcgtcctcctc
ctgaaagtggccgggtttaacctgttcgtgacgctgcgcctgtggtcccgatga

DBGET integrated database retrieval system