KEGG   Amycolatopsis mediterranei S699: AMES_1119Help
Entry
AMES_1119         CDS       T02190                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
amm00860  Porphyrin and chlorophyll metabolism
amm01100  Metabolic pathways
amm01110  Biosynthesis of secondary metabolites
amm01120  Microbial metabolism in diverse environments
Module
amm_M00121  Heme biosynthesis, glutamate => heme
amm_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AMES_1119 (hemD)
Enzymes [BR:amm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     AMES_1119 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AFO74655
UniProt: G0G5V4
Position
1192754..1193857
Genome map
AA seq 367 aa AA seqDB search
MSDVLPLAGFVIGITAARRADELGALLVRKGASVRYGPAIRIVPLTDDTELHAATSRLLE
APVDAVVATTGIGFRGWLEAAEGWGLGDSLLERLSSASLLARGPKVTGALRAAGLSESYS
PASESNAELLQHLLSSGVDGLRIAVQLHGEPLPYFVDTLRASGAEVIEIPVYRWVGPVDP
GPVDRLLDGVLDGSIHALPFTSAPAAASLIALARRTGRLPGLVSALSGPVVAACVGPITA
GPLAALGVPTVQPHRARIGALARTVAETLVARSPRLRAGGHSIELRGQAAIVDGEWREVA
PAPMALLRALAASPGRVVSRRELISALPGGGEEHAVETAIGRLRTALGGGKVVQTVVKRG
YRLAVDA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgatgtgctcccactggccggtttcgtgatcggcatcaccgcggcgcgccgggct
gacgagctcggcgcgctgctggtgcgcaagggggcgagcgtccgctacggcccggcgatc
cggatcgtgccgctgacggacgacaccgagctgcacgcggcgacgtcgaggctgctggaa
gcgccggtggacgcggtggtggcgacgacgggcatcggtttccgtggctggctcgaagcg
gccgaggggtgggggctgggggattccctgctcgagcggctgtcttcggcgtcgctgctg
gcccgcgggccgaaggtgaccggtgcgttgcgggcggccgggctttcggagtcgtattcg
cccgcctcggaaagcaacgccgagctgctgcagcacctgctctcgtcgggcgtcgacggg
ctgcggatcgcggtccagctgcacggcgagccgttgccgtacttcgtggacacgctgcgg
gcgtccggggcggaggtcatcgagatcccggtgtaccgctgggtcggcccggtcgacccg
ggcccggtggaccggctcctggacggcgtcctggacggctcgatccacgcgctgccgttc
acgagcgccccggcggcggcgtcgctcatcgccctggcccggcgcacgggccggctgccg
gggctcgtttcggcgctgtccggcccggtggtggcggcgtgcgtcggcccgatcacggct
ggaccgttggccgctttgggggtgccgacggtccagccgcaccgcgcccgcatcggcgcg
ctggcccggacggtggcggagaccctggtggcccgttccccgcggttgcgggcgggaggt
cactcgatcgagctgcgcggccaggcggccatcgtggacggcgagtggcgcgaagtggcc
ccggcaccgatggcgctgttgcgggcgctggcggcgtcgccggggcgggtggtgtcccgg
cgtgagctgatctcggcgctgccgggaggcggcgaggagcacgcggtcgagacggcgatc
gggcggctgcggacggcgctggggggcgggaaggtcgtccagacggtggtgaagcgcgga
tatcggctggcggtcgacgcctga

DBGET integrated database retrieval system