KEGG   Amycolatopsis mediterranei S699: AMES_2267Help
Entry
AMES_2267         CDS       T02190                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
amm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
amm01100  Metabolic pathways
amm01110  Biosynthesis of secondary metabolites
amm01130  Biosynthesis of antibiotics
amm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AMES_2267 (trpC)
Enzymes [BR:amm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     AMES_2267 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh NanE OMPdecase DUF3509
Motif
Other DBs
NCBI-ProteinID: AFO75803
UniProt: G0G4X4
Position
2448418..2449227
Genome map
AA seq 269 aa AA seqDB search
MSVLEDIVAGVREDLAVRESALPFDELKIRAAAAPAPRDVMAALRESGIGVIAEVKRRSP
SKGDLADIPDPAALAKDYEAGGARVISVLTEQRRFGGSLADLDAVRAAVDIPILRKDFVV
SPYQVHEARLHGADMVLLIVAALEQNALVSLLDRVESLGMTALVEIHNAEEADRALEAGA
KVIGVNARNLHTLEVDRDVFSRLAPGLPMDVYKVAESGVRGPGDLMSYAGHGADAVLVGE
GLVASGDPKGALVKLVTAGSHPACPRPSR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtgctcgaagacatcgtcgccggcgtgcgggaagatctcgccgtgcgggaatcc
gcgctgccgttcgacgagctgaagatccgcgcggccgccgccccggcgccgcgcgacgtg
atggccgccctgcgcgagtccggcatcggcgtgatcgccgaagtcaagcggcgcagccct
tcgaagggcgacctggccgacatccccgacccggccgcgctggcgaaggactacgaagcc
ggcggggcgcgcgtgatcagcgtgctcaccgagcagcgccgcttcggcggttcgctggcc
gacctggacgcggtccgcgcggcggtggacatccccatcctgcgcaaggacttcgtcgtc
agcccctaccaggtgcacgaggcccgcctgcacggcgccgacatggtgctgctgatcgtc
gccgcgctggagcagaacgcgctcgtctcgctgctcgaccgcgtcgaatcgctcggcatg
accgcgctggtggagatccacaacgccgaggaggccgaccgggccctcgaggcgggcgcc
aaggtcatcggcgtcaacgcgcgcaacttgcacaccctcgaggtggaccgggacgtcttc
tcgcggctggcccccggcctgccgatggacgtctacaaggtcgccgagtccggtgtccgc
ggcccgggcgacctgatgtcctacgccggccacggcgccgacgcggtgctggtcggcgag
gggctcgtcgcctccggcgacccgaagggcgccctggtcaagctggtcaccgccggttcc
caccccgcctgcccgaggccgtcccggtga

DBGET integrated database retrieval system