KEGG   Amycolatopsis mediterranei S699: AMES_2424Help
Entry
AMES_2424         CDS       T02190                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
amm00010  Glycolysis / Gluconeogenesis
amm00052  Galactose metabolism
amm00500  Starch and sucrose metabolism
amm00520  Amino sugar and nucleotide sugar metabolism
amm00521  Streptomycin biosynthesis
amm01100  Metabolic pathways
amm01110  Biosynthesis of secondary metabolites
amm01120  Microbial metabolism in diverse environments
amm01130  Biosynthesis of antibiotics
amm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMES_2424 (glk)
   00052 Galactose metabolism
    AMES_2424 (glk)
   00500 Starch and sucrose metabolism
    AMES_2424 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    AMES_2424 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AMES_2424 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    AMES_2424 (glk)
Enzymes [BR:amm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     AMES_2424 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase
Motif
Other DBs
NCBI-ProteinID: AFO75960
UniProt: G0G7E5
Position
2623435..2624373
Genome map
AA seq 312 aa AA seqDB search
MDVGGTSIRAGVVDERGSLLDTARVATPTEEGALEDAIAGVVEDLRNRHDVAGVGLAVAG
FVARDRRSVMFAPHLAWRGAPVADRIEKRVGLPVLLEHDVNSAIVGEHRFGAARGAQVAA
LVALGTGIGAGLLLDGKLYRGAYGVAPELGHLTVVRGGRPCPCGKYGCWERYCSGTALAA
TAVELLARHPGRSTVLAPQVAGDPGSVTGRRVAGAARDGDPIAQLAMAELAKWLGEGLAL
VADVFDPEIIVIGGGVSESAPLFLDEAREHYAATITGARHRPLARIRTAHLGDDTAIVGA
AALALEAAKTPV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtggacgtcggcgggacgagcatccgggccggcgtggtggacgaacgcggctccctgctc
gacacggcccgcgtcgcgacgccgaccgaggaaggcgccctcgaggacgccatcgccggc
gtggtcgaggacctgcgcaaccggcacgacgtggccggggtcgggctggcggtggcgggc
ttcgtcgcgcgcgaccgccggtcggtgatgttcgccccgcacctggcgtggcgcggcgcc
ccggtcgccgaccggatcgaaaagcgcgtcggcctgccggtgctgctggagcacgacgtc
aattcggcgatcgtcggcgagcaccgcttcggcgcggcccgcggcgcccaggtggcggcc
ctggtggccctgggcacgggcatcggcgcgggactgttgctggacggcaagctgtatcga
ggcgcgtacggcgtcgcgccggagctgggccacctgacggtggtccgcggcggccgcccc
tgcccgtgcggcaagtacggttgctgggagcggtactgcagcggaacggccctggcggcc
acggcggtggagctgctggcgcggcacccgggccgctcgacggtgctggccccccaggtc
gcgggcgacccgggctcggtgacgggccgccgggtggcgggcgcggcccgcgacggcgac
ccgatcgcccagctggcgatggcggaactggccaagtggctgggtgagggcttggcgctg
gtggcggacgtgttcgacccggagatcatcgtgatcggcggcggggtgtcggagtcggcc
ccgctgttcctggacgaggcccgcgagcactacgcggccacgatcacgggcgcccgccac
cggccgctggcccgcatcaggacggcccacctcggcgacgacacggcgatcgtcggtgca
gcggccctggccctggaagcggcgaagaccccggtctga

DBGET integrated database retrieval system