KEGG   Amycolatopsis mediterranei S699: AMES_2574Help
Entry
AMES_2574         CDS       T02190                                 

Gene name
ppgK
Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
amm00010  Glycolysis / Gluconeogenesis
amm00520  Amino sugar and nucleotide sugar metabolism
amm01100  Metabolic pathways
amm01110  Biosynthesis of secondary metabolites
amm01120  Microbial metabolism in diverse environments
amm01130  Biosynthesis of antibiotics
amm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMES_2574 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    AMES_2574 (ppgK)
Enzymes [BR:amm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     AMES_2574 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AFO76110
UniProt: G0G8Z3
Position
complement(2792292..2793059)
Genome map
AA seq 255 aa AA seqDB search
MVEATRRGFGIDIGGSGIKGALVDLDSGQLIGDRIRIETPKPSTPSAVADVVHDVVTQAG
WDGPVGVTLPAVVKKGVAHTAANIDKQWIGTDADALFAKRLGRSVDQVAMLNDADAAGMA
EIRFGDPVARTGVTALLTFGTGIGSAVFQDGKLVPNTEFGHLEIDGHDAEKRAAASVKDN
EGLSYPEWAKRVHRYLTVLENLIWPDLFIVGGGVSKKAEKWVPLLDIRTPVLVASLQNNA
GIVGAAAAAAEGIQH
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtggtggaggcgacccgccgaggtttcggcatcgacatcggcggcagcgggatcaagggc
gccttggtcgacctggactccggccagctcatcggcgaccgcatccggatcgagacgccg
aaaccgtccacgccgtcggcggtggcggacgtcgtgcacgacgtcgtcacgcaggcgggc
tgggacggcccggtcggcgtgaccctgccggcggtcgtcaagaagggcgtcgcgcacacc
gcggccaacatcgacaagcagtggatcggcaccgacgccgacgcgctgttcgccaagcgg
ctcggccggagcgtcgaccaggtcgcgatgctgaacgacgccgacgcggcgggcatggcg
gagatccgcttcggcgacccggtcgcgcgcacgggcgtgacggcgctgctcaccttcggc
accggcatcggcagcgcggtgttccaggacggcaagctcgtccccaacaccgaattcggc
cacctcgagatcgacggccacgacgccgagaagcgcgcggccgcttcggtgaaggacaac
gaggggctctcctaccccgaatgggccaagcgcgtgcaccgttacctgaccgtgctggag
aacctgatctggcccgacctgttcatcgtcggcggcggcgtcagcaagaaggccgagaaa
tgggtgccgctgctggacatccgcactccggtgctggtggcgagcctgcagaacaacgcc
gggatcgtcggcgccgcggccgccgcggcggagggcatccagcactga

DBGET integrated database retrieval system