KEGG   Amycolatopsis mediterranei S699: AMES_2811Help
Entry
AMES_2811         CDS       T02190                                 

Definition
(GenBank) metalloprotease
  KO
K01416  snapalysin [EC:3.4.24.77]
Organism
amm  Amycolatopsis mediterranei S699
Brite
KEGG Orthology (KO) [BR:amm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:amm01002]
    AMES_2811
Enzymes [BR:amm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.77  snapalysin
     AMES_2811
Peptidases and inhibitors [BR:amm01002]
 Metallo peptidases
  Family M7: snapalysin family
   AMES_2811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M7 Peptidase_M6 Peptidase_M66 Peptidase_M10 Reprolysin_5 Reprolysin_3 Astacin Reprolysin_4
Motif
Other DBs
NCBI-ProteinID: AFO76347
Position
3040248..3040787
Genome map
AA seq 179 aa AA seqDB search
MNGRVMGRVAALVIAAPLALGLATAPAASAAAVTTLYYSSSGAPDYLAQIDQGAANWNAA
VTDVKLVKRNTSATIVFHEIHSGGSYTNTNGHGRGQIYLDTSQVAEGFDPTRIAAHELGH
NLGLPDHYSGPCTELMSGHGPGTACKNAKPSAAEAAKVQSLWVNGLVAQAAAENRAVAY
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaacggacgcgtgatgggccgggtggcggcgttggtcattgcggccccgctggccctg
ggcttggccaccgccccggccgcctcggcggcggctgtcacgacgctgtactacagctct
tcgggcgcgccggactacctcgcccagatcgaccagggcgcggccaactggaacgccgcg
gtcaccgacgtgaagctggtcaagcggaacacgagcgccaccatcgtgttccacgaaatc
cacagcggcggctcgtacacgaacacgaacggccacggccgcgggcagatctacctggac
acgagccaggtggcggaagggttcgacccgacccgcatcgcggcgcacgagctggggcac
aacctgggcctgccggaccactacagcggcccgtgcacggagctgatgtccggccacggc
ccgggcacggcgtgcaagaacgcgaagccgtctgcggcggaagcggcgaaggtgcagtcc
ttgtgggtgaacggattggtggcccaggcggctgccgagaaccgcgcggtcgcttactga

DBGET integrated database retrieval system