KEGG   Amycolatopsis mediterranei S699: AMES_3053Help
Entry
AMES_3053         CDS       T02190                                 

Definition
(GenBank) mandelate racemase
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
amm00051  Fructose and mannose metabolism
amm01100  Metabolic pathways
amm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:amm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AMES_3053
Enzymes [BR:amm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     AMES_3053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N
Motif
Other DBs
NCBI-ProteinID: AFO76589
UniProt: G0FIH0
Position
3300474..3301796
Genome map
AA seq 440 aa AA seqDB search
MDPLAEVISAIDAVDVRFPTSLSLDGSDAMNPEPDYSAAYVTIRTSDGDEGYGLAFTVGR
GNDVEVAAVRALVPLVVGMPVSDALADLGAFSRRLTGDSQLRWLGPDKGAIHMAAAAIVN
AAWDLRARREGKPVWRLLAEMPPEELVGLVDFRYLQDALTPGEALDILRRAEPGRAARQA
ELLDSGFPAYTTTPGWLGYSPEKLAALAKEAVEDGFTQIKLKVGADLDEDVRRLRLAREV
VGPDVRIAIDANQAWGVGQAIEWLRPLAEFDPYWIEEPTSPDDVLGHAAIRRAVAPIKVA
TGEHTHNAVMFKQLLQAEAIDVLQLDASRVAGVTENVAILLLAAKFGVPVCPHAGGVGLC
EMVQHLAMFDFVAVSGTQTDRVIEYVDHLHEHFVDPVRIERGRYLAPVEPGLGARLHTES
VARYRFPDGPVWQRDAVVVA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtggacccgttggccgaagtgatcagcgcgatcgacgccgtggacgtgcgcttcccgact
tcgctgagcctggacgggtcggacgcgatgaacccggaacccgactactcggcggcctac
gtgacgatccgcacgagcgacggcgacgagggctacgggctcgccttcaccgtgggccgc
ggcaacgacgtcgaggtcgccgccgtccgggcgctcgtgcccctggtcgtcgggatgccg
gtgagcgacgcgctcgccgacctcggcgccttttcccgccggctgaccggcgacagccag
ctccggtggctgggcccggacaagggcgcgatccacatggccgccgcggcgatcgtcaac
gcggcctgggacctgcgggcccgccgcgaaggcaagccggtgtggcggctgctggccgaa
atgccgccggaggaactggtcggcctggtcgacttccggtacctgcaggacgcgctgacc
cctggcgaagccctcgacatcctccgccgtgccgaaccgggccgcgcggcgcgccaggcc
gaactcctggactccggttttcccgcctacaccacgactcccggctggctcgggtactcg
ccggagaagctggcggcgctcgcgaaggaggcggtcgaagacgggttcacccagatcaag
ctcaaggtcggcgccgacctcgacgaggacgtccgccggctgcggctggcgcgcgaggtc
gtggggccggacgtccggatcgccatcgacgccaaccaggcctggggcgtcgggcaggcc
atcgaatggctgcgcccgctcgccgagttcgacccgtactggatcgaggagccgacctcg
cccgacgacgtgctcggccacgcggcgatccgccgggcggtcgcgccgatcaaggtggcc
accggcgagcacacccacaacgcggtgatgttcaagcagctgctgcaggcggaggcgatc
gacgtcctccagctcgacgcgagccgggtcgccggggtcaccgagaacgtcgcgatcctg
ttgctggccgcgaagttcggcgtcccggtgtgcccgcacgccggcggggtcgggctgtgc
gagatggtgcagcacctggcgatgttcgacttcgtcgcggtgagcggcacccagaccgac
cgggtcatcgagtacgtggaccacctgcacgagcacttcgtcgacccggtgcggatcgag
cggggccgctacctggccccggtcgaaccgggactcggggcgcggctgcacaccgaatcc
gtggcccggtaccggtttcccgacggcccggtctggcagcgcgacgcggtggtggtcgcg
tga

DBGET integrated database retrieval system