KEGG   Amycolatopsis mediterranei S699: AMES_4937Help
Entry
AMES_4937         CDS       T02190                                 

Gene name
acs
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
amm00010  Glycolysis / Gluconeogenesis
amm00620  Pyruvate metabolism
amm00640  Propanoate metabolism
amm00680  Methane metabolism
amm01100  Metabolic pathways
amm01110  Biosynthesis of secondary metabolites
amm01120  Microbial metabolism in diverse environments
amm01130  Biosynthesis of antibiotics
amm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMES_4937 (acs)
   00620 Pyruvate metabolism
    AMES_4937 (acs)
   00640 Propanoate metabolism
    AMES_4937 (acs)
  Energy metabolism
   00680 Methane metabolism
    AMES_4937 (acs)
Enzymes [BR:amm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AMES_4937 (acs)
Lipid biosynthesis proteins [BR:amm01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AMES_4937 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AFO78473
UniProt: G0G060
Position
complement(5529009..5530712)
Genome map
AA seq 567 aa AA seqDB search
MSASEVHHAFRVARDYLLTHREDYDTAYRDFAWPEFDEFNWAIDWFDVVAHDPDNAERYA
LWIVEEDGTENRWTYPELSGRSNQVANWLRNLGVRRGDRLILMLGNQGELWETILAAIKL
GAVIIPASTLLGPADLADRVERGAAKHVVVRSVDAPKFDGVTGDYTRIVVGEPVDGWHSY
SAAFAESPEYAPDGPTQAGDPLLLYFTSGTTAKPKLVQHTHVSYPVGHLSTMYWIGLEPG
DVHLNISSPGWAKHAWSNFFAPFNAEATVFLYNYGRFDAGALMAQMDRCGVTSFCAPPTV
WRMLIQADLTALGTRPRKVVGAGEPLNPEVIEQVRKSWGVTIRDGFGQTESSVQIANTPG
QDVVPGSMGRPLPGFVVALVDPVSGERATEGEICLDLAHRPVGLMTGYADDDERTSAAFG
GGFYHTGDVASVDERGYLTYVGRTDDVFKASDYRISPFELESVLIEHEAVAEAAVVPAPD
PIRLAVPKAYVVLAVGFSADAETARSILAYCREHLAPYKRIRRLEFAELPKTISGKIRRV
ELRGRESDPKRGQGTEYREEDFPDLKS
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcttcggaggtccaccacgcgttccgcgtcgcgcgggactacctgttgacccac
cgcgaggactacgacacggcgtaccgcgacttcgcctggccggagttcgacgagttcaac
tgggcgatcgactggttcgacgtcgtcgcgcacgacccggacaacgccgagcggtacgcg
ctgtggatcgtcgaggaggacggcaccgagaaccgctggacctacccggagctgtccggc
cggtccaaccaggtggcgaactggctgcggaacctcggcgtccgccgcggcgaccggctg
atcctcatgctgggcaaccagggcgagctgtgggagacgatcctcgccgcgatcaagctc
ggcgcggtgatcatcccggcctccaccctgctcgggccggccgacctggccgaccgggtg
gagcgcggcgccgccaagcacgtcgtcgtccgctcggtggacgcgccgaagttcgacggc
gtgaccggcgactacacccggatcgtggtgggggagccggtcgacggctggcactcgtac
tcggcggcgttcgccgagtcgccggaatacgccccggacggccccacgcaggccggcgac
ccgctgctgctgtacttcacctccggcacgaccgcgaagccgaagctggtgcagcacacg
cacgtctcgtaccccgtgggccacctgtccacgatgtactggatcgggctggagcccggc
gacgtccacttgaacatctcctcgccgggctgggcgaagcacgcgtggagcaacttcttc
gcgccgttcaacgccgaggcgacggtgttcctctacaactacggccggttcgacgcgggc
gccctgatggcgcagatggaccgctgcggcgtgacgagcttctgcgcgccgccgacggtg
tggcggatgctcatccaggccgatctgacggcgctcggcacacggccgcgcaaggtcgtc
ggggcgggggagccgctcaaccccgaggtgatcgagcaggtccggaagtcgtggggcgtc
accatccgcgacggcttcggccagaccgaaagcagcgttcagatcgcgaacacgccgggc
caggacgtcgtgcccggttcgatgggccgcccgctgcccggcttcgtggtggcgctggtg
gacccggtcagcggcgagcgcgccacggagggcgagatctgcctggacctcgcccaccgg
ccggtgggcctgatgaccgggtacgcggacgacgacgagcgcacgtcggcggccttcggc
ggcggcttctaccacaccggtgacgtcgcttcggtcgacgaacgcggctacctcacctac
gtcgggcgcaccgacgacgtgttcaaggcgtcggactaccgcatctcgccgttcgaactg
gagagcgtcctcatcgagcacgaggcggtggccgaggcggcggtcgtcccggcccccgac
ccgatccggctcgcggtgcccaaggcctacgtcgtgctggccgtggggttctccgcggac
gccgagaccgcgcggtcgatcctggcgtactgccgggagcacctggcgccgtacaagcgg
atccgccggctggagttcgcggagctgccgaagacgatctcgggcaagatccgccgcgtc
gagctgcggggccgcgagagcgacccgaagcgcggccaggggaccgagtaccgcgaagag
gacttcccggacctcaagtcctga

DBGET integrated database retrieval system