KEGG   Amycolatopsis mediterranei S699: AMES_5870Help
Entry
AMES_5870         CDS       T02190                                 

Gene name
bdh
Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
amm00072  Synthesis and degradation of ketone bodies
amm00650  Butanoate metabolism
amm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    AMES_5870 (bdh)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    AMES_5870 (bdh)
Enzymes [BR:amm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     AMES_5870 (bdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase NAD_binding_10 KR 3Beta_HSD ADH_zinc_N NAD_binding_7 TrkA_N Methyltransf_24 AdoHcyase_NAD GDP_Man_Dehyd UDPG_MGDP_dh_N Polysacc_synt_2 NAD_binding_3 Methyltransf_11 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AFO79406
UniProt: G0FW86
Position
complement(6604437..6605186)
Genome map
AA seq 249 aa AA seqDB search
MTSDLDGRTALVTGGASGIGLACVRALAAAGAKVHVVDIDEHRTEAVASEVGGWAHVADL
TDPTSIDALPAEVDVLVNNAGIQHVAPLEDFPPEVFTRIQALMVTAPFLLIRHTLPAMYA
RGWGRIVNMSSVHGLRASAFKAAYVAAKHGLEGLSKVAALEGAEHGVTSNCVNPGYVRTP
LVDGQIDAQAAEHDIPREDVVAEVLLKRAAIKKLIEPEDVASLVVWLCSPHAGHITGASI
PLDGGWTAA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgatctggacgggcgcaccgccctcgtcaccggcggtgcgagcggcatcggc
ctcgcctgcgtccgcgctctcgccgcggccggggcgaaggtgcacgtcgtcgacatcgac
gaacaccgcaccgaggccgtcgcctccgaggtgggcggctgggcgcacgtcgccgacctc
accgaccccacctcgatcgatgccctgcccgccgaagtcgacgtcctggtcaacaacgcc
gggatccagcacgtcgcgcccctcgaagacttcccgcccgaggtcttcacgcggatccag
gccctgatggtcaccgctcctttcctgctcatccggcacaccctccccgcgatgtacgcc
cgggggtggggccggatcgtcaacatgtcgagcgtccacgggctgcgcgcctccgccttc
aaagccgcttacgtcgctgccaaacacggcctagaaggcctgtcgaaggtcgccgccctg
gaaggcgccgaacacggcgtcacgagcaattgcgtgaaccccgggtacgtccgcactccg
ctggtcgacgggcagatcgacgcccaggccgccgagcacgacatcccgcgtgaggacgtc
gtcgccgaggtcctcctcaagcgggccgcgatcaagaagctcatcgaacccgaggacgtc
gcttccctggtggtgtggctgtgctccccgcacgccggccacatcaccggggcctccatc
ccgctcgacggcggttggaccgccgcttaa

DBGET integrated database retrieval system