KEGG   Amycolatopsis mediterranei S699: AMES_6276Help
Entry
AMES_6276         CDS       T02190                                 

Gene name
paaG
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
amm00071  Fatty acid degradation
amm00280  Valine, leucine and isoleucine degradation
amm00281  Geraniol degradation
amm00310  Lysine degradation
amm00360  Phenylalanine metabolism
amm00362  Benzoate degradation
amm00380  Tryptophan metabolism
amm00410  beta-Alanine metabolism
amm00627  Aminobenzoate degradation
amm00640  Propanoate metabolism
amm00650  Butanoate metabolism
amm00903  Limonene and pinene degradation
amm00930  Caprolactam degradation
amm01100  Metabolic pathways
amm01110  Biosynthesis of secondary metabolites
amm01120  Microbial metabolism in diverse environments
amm01130  Biosynthesis of antibiotics
amm01212  Fatty acid metabolism
Module
amm_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AMES_6276 (paaG)
   00650 Butanoate metabolism
    AMES_6276 (paaG)
  Lipid metabolism
   00071 Fatty acid degradation
    AMES_6276 (paaG)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AMES_6276 (paaG)
   00310 Lysine degradation
    AMES_6276 (paaG)
   00360 Phenylalanine metabolism
    AMES_6276 (paaG)
   00380 Tryptophan metabolism
    AMES_6276 (paaG)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AMES_6276 (paaG)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AMES_6276 (paaG)
   00281 Geraniol degradation
    AMES_6276 (paaG)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AMES_6276 (paaG)
   00627 Aminobenzoate degradation
    AMES_6276 (paaG)
   00930 Caprolactam degradation
    AMES_6276 (paaG)
Enzymes [BR:amm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AMES_6276 (paaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 UPF0444
Motif
Other DBs
NCBI-ProteinID: AFO79812
UniProt: G0FK41
Position
7052177..7052926
Genome map
AA seq 249 aa AA seqDB search
MTEVRTERIGSTLLITIDRPQARNAVNAAVAAGLAAALDELESDPTLRAGVLTGAENTFS
AGMDLKAALKGESPEIRGRGFGGLTEAELTKPLIAAVEGFAMGGGFELALGCDLIVAGET
AQFGLPEVKRGLIAAGGGVIRLPKRIPHHLAMEFLLTGEPVTGRRAGELGLVNRVTADGD
AAAVAVGLAEKLAENAPLALAAVKKIVRGSEAEAFAVQREETKKLMQSNDVREGMTAFAE
RRAPKWTGE
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagtacgcaccgaacggatcggcagcaccctgctgatcaccatcgaccggccc
caggcccgcaacgcggtcaacgccgcggtcgcggccgggctggccgccgccctcgacgaa
ctcgagagcgaccccaccctccgggcgggtgtcctgaccggcgcggagaacaccttcagc
gccggcatggacctcaaggccgcactcaagggcgagtccccggagatccgcggccgcggg
ttcgggggcctgaccgaagccgagctgaccaagccgctgatcgccgccgtcgaagggttc
gccatgggcggcgggttcgaactggcactgggctgcgacctgatcgtcgccggggaaacc
gcgcagttcggcctgcccgaggtcaagcgcggcctgatcgccgcgggcggcggcgtgatc
cggctgccgaagcggatcccgcaccacctcgcgatggagttcctgctcaccggcgagccc
gtcaccggccgccgcgccggcgagctcggcctggtcaaccgcgtgaccgccgacggcgac
gccgccgcggtcgccgtcggcctcgccgagaagctggcggagaacgcacccctcgcgctt
gccgccgtcaagaagatcgtgcgcggctcggaggccgaagcctttgccgtgcaacgcgaa
gagaccaaaaagctgatgcagtccaacgacgtccgcgagggcatgaccgccttcgccgag
cgccgcgctccgaagtggacaggcgaatga

DBGET integrated database retrieval system