KEGG   Amycolatopsis mediterranei S699: AMES_7589Help
Entry
AMES_7589         CDS       T02190                                 

Gene name
murI
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
amm00471  D-Glutamine and D-glutamate metabolism
amm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    AMES_7589 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:amm01011]
    AMES_7589 (murI)
Enzymes [BR:amm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     AMES_7589 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:amm01011]
 Precursor biosynthesis
  Racemase
   AMES_7589 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race AftA_N Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: AFO81122
Position
complement(8505444..8506217)
Genome map
AA seq 257 aa AA seqDB search
MFDSGVGGLTVARAILEQLPAEQLRYVGDTAHNPYGPLPIATARSYALAALDELVESGVK
ALVIACNTASAACLRDARERYDVPVIEVVLPAVRRAVVATHTGRVGVIGTEGTVRSRAYE
DAFAAAPAITLTSVACPRFVDFVERGITTGRQVLGLAQGYLQPLLDAQVDTLVLGCTHYP
LLQGVLQIVMGQEVTLVSSADETAKDLVRVLTEGDLLTTRDTPPRHEFLATGSAEPFTRL
AQRFMGFAPGVLAPTTA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgattccggcgtcggcgggctgacggtggcgagggcgatcctcgagcagctgccc
gccgagcagctccgctacgtcggcgacacggcgcacaacccgtacggcccgctcccgatc
gccaccgcccgcagctacgcgctcgcggcgctcgacgagctcgtggagagcggggtgaag
gcactggtgatcgcctgcaacaccgcgtccgcggcctgcctgcgcgacgcgcgcgagcgc
tacgacgtcccggtgatcgaggtcgtcctgcccgccgtgcgccgcgccgtcgtggcgacg
cacaccggccgcgtcggcgtgatcggcaccgagggcaccgtgcggtcgcgggcctacgaa
gacgccttcgccgcggcgcccgccatcacgctcaccagcgtcgcctgcccgcggttcgtc
gacttcgtcgagcgcggcatcacgaccgggcgccaggtgctcgggctggcgcagggctac
ctccagccgctgctcgacgcccaggtcgacacgcttgtcctcggctgcacgcactacccg
ctgctgcaaggagtgctgcagatcgtgatgggccaggaggtcacgctcgtgtcgagcgcg
gacgagaccgccaaggacctcgtccgcgtgctcaccgagggggacctgctgaccacgcgg
gacaccccgccgcggcacgagttcctcgccaccgggtcggcggagccgttcacccggctc
gcccagcggttcatggggttcgccccgggtgtcctcgctcccaccaccgcgtga

DBGET integrated database retrieval system