KEGG   Amycolatopsis mediterranei S699: AMES_8138Help
Entry
AMES_8138         CDS       T02190                                 

Definition
(GenBank) beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
amm00511  Other glycan degradation
amm00520  Amino sugar and nucleotide sugar metabolism
amm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AMES_8138
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AMES_8138
Enzymes [BR:amm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AMES_8138
Chaperones and folding catalysts [BR:amm03110]
 Intramolecular chaperones
  Others
   AMES_8138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b Glycohydro_20b2
Motif
Other DBs
NCBI-ProteinID: AFO81671
UniProt: G0FWX0
Position
9101812..9103377
Genome map
AA seq 521 aa AA seqDB search
MRLSRAVLTAAVVSLTAAGLPASAVAAAAAPERSVTDVVPAPVSAKADPRGEFRLTPSTV
ITADHGAGQVADYLRGLLRPATGFPLPVVPNAAGLPALSLKLGHDARIGTEGYELKVARD
GVTVKANTADGLFEGVQSLRQLLPSAIDAKRVQHRTWTVAGGTILDYPRFAERGAMLDVA
RHFFRPDQVKLYLDQIAQYKVNTLHLHLADDQGWRIEIKSWPKLATVGGKTAVDGDPGGY
YTQAQYQDIVAYAASRHITVIPEIDMPGHTNAAQSTYAELNCDGKAVPVRTDTEVGYSSL
CISSPITYKFVEDVVRELAALTPGPYLHIGGDEAHSTPPADYLTFERKVQPIVAKYGKKV
TGWHEIAKSVPPVSAVPQYWDFGGDNPDVAAAAARGNKILMSPANYAYLDMKYNAQTPLG
QDWAALIEVKDGYNWDPASLVNGVGESQVAGVEAPLWTETIRTSDDIEYMAFPRLPGIAE
IGWSPKSTHNWNAYRARLAKQAPRWVAQGIDFYRSPQVDWK
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttgtccagagccgtcctgaccgcggccgtcgtgagtctcacggccgccggcctg
cccgcttccgcggtggccgccgcggccgctcccgaacggagcgtgaccgacgtcgtcccg
gcgcccgtctccgcgaaggccgatcctcgcggtgaattccggctcacgccgtccaccgtg
atcaccgccgaccacggcgccggccaggtcgcggactacctgcgcggcctgctgcgcccg
gctaccggcttcccgctgccggtcgtgccgaacgccgccggcctgcccgcgctctcgctg
aagctgggccacgacgcgcggatcggcaccgagggttacgagctgaaggtcgcacgcgac
ggcgtcacggtgaaagccaacaccgccgacgggctcttcgaaggcgtccagtcgctgcgg
cagctgctgccgtcggcgatcgacgcgaagcgcgtgcagcaccggacgtggaccgtcgcc
ggcggcacgatcctcgactacccgcgcttcgccgagcgcggcgcgatgctcgacgtcgcc
cggcacttcttccggcccgaccaggtgaagctgtacctcgaccagatcgcccagtacaag
gtcaacacgctgcacctgcacctggccgacgaccagggctggcggatcgagatcaagagc
tggccgaagctggccacggtcggcggcaagaccgcggtcgacggcgacccgggtggctac
tacacgcaggcgcaataccaggacatcgtcgcgtacgcggcttcgcggcacatcacggtg
atcccggagatcgacatgccgggccacaccaacgcggcgcagtcgacgtacgccgagctg
aactgcgacgggaaggccgtgccggtgcgcacggacaccgaggtcggctacagctcgctg
tgcatctcctcgccgatcacctacaagttcgtcgaggacgtcgtgcgcgagctggcggcc
ctcacgcccggcccgtacctgcacatcggcggcgacgaggcgcactcgacaccgcccgcg
gactacctgaccttcgagcggaaggtgcagccgatcgtcgccaagtacggcaagaaggtc
accggctggcacgagatcgccaagtcggtcccgccggtgtcggcggtgccgcagtactgg
gacttcggcggcgacaacccggacgtcgcggcggccgcggcgcgcggcaacaagatcctg
atgtcgccggcgaactacgcctacctcgacatgaagtacaacgcgcagacgccgctcggc
caggactgggccgcgctgatcgaggtgaaggacgggtacaactgggatccggcgtcgctg
gtgaacggcgtcggcgagagccaggtcgcgggcgtcgaagcgccgctgtggaccgagacg
atccggaccagcgacgacatcgagtacatggcgttcccgcggctcccgggcatcgcggag
atcggctggtccccgaagtcgacgcacaactggaacgcctaccgcgcgcggctggcgaag
caggccccgcgctgggtggcgcagggcatcgacttctaccgctccccgcaggtcgactgg
aagtga

DBGET integrated database retrieval system