KEGG   Amycolatopsis mediterranei S699: AMES_8853Help
Entry
AMES_8853         CDS       T02190                                 

Gene name
galA
Definition
(GenBank) alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
amm00052  Galactose metabolism
amm00561  Glycerolipid metabolism
amm00600  Sphingolipid metabolism
amm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AMES_8853 (galA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    AMES_8853 (galA)
   00600 Sphingolipid metabolism
    AMES_8853 (galA)
Enzymes [BR:amm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     AMES_8853 (galA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase_2 Melibiase Glyco_hydro_97 Raffinose_syn
Motif
Other DBs
NCBI-ProteinID: AFO82385
UniProt: G0FNZ1
Position
9853499..9854173
Genome map
AA seq 224 aa AA seqDB search
MLAAIAGLLSALVVFAPPSSAAAAAPITKPPMGWNSWNSFAGTIDHTVIERQADALVTSG
MKDAGYEYVNIDDGWWTGSRDGGGNITVDTAKWPGGMSAIADYIHSKGLKAGIYTDAGRN
GCGYYYPTGHPAYPGTGAEGHYDQDFLQFSRWGFDYVKVDWCGGSAEGLNARNSYTAISD
SIARATAQTGRPMVFSVCEWGGQQPWNWAPSIANLWRTSGDIIY
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgcggcgatcgcgggcctgctgtccgctttggtggtcttcgcgcctccgtcgagt
gccgcggcggcggccccgatcaccaagcccccgatggggtggaactcctggaactccttc
gccgggacgatcgaccacaccgtcatcgagcggcaggcggacgcgctcgtgacctccggc
atgaaggacgcgggctacgagtacgtcaacatcgacgacggctggtggacgggctcccgt
gacgggggaggcaacatcaccgtcgacaccgcgaagtggcccggcgggatgtccgccatc
gccgactacatccacagcaaagggctgaaagcgggcatctacaccgacgccggccgcaac
ggctgtggctactactacccgaccggccatcccgcctaccccggcaccggcgccgaaggc
cactacgaccaggacttcctccagttctcccgctggggcttcgactacgtgaaggtcgac
tggtgcggcggctcggccgaagggctcaacgcccgcaactcctacaccgcgatcagcgac
tccatcgcgcgcgccaccgcccagacgggacggccgatggtgttctccgtctgcgaatgg
ggcggccagcagccgtggaactgggcgccgtccatcgccaacctgtggcgcaccagcggc
gacatcatctactga

DBGET integrated database retrieval system