KEGG   Amycolatopsis mediterranei S699: RAM_00990Help
Entry
RAM_00990         CDS       T01822                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00310  Lysine degradation
amn01100  Metabolic pathways
amn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:amn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    RAM_00990
Enzymes [BR:amn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     RAM_00990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 Pyr_redox NAD_binding_8 Pyr_redox_2 Amino_oxidase HI0933_like FAD_binding_3 Pyr_redox_3 AlaDh_PNT_C GIDA Thi4 NAD_binding_7 ApbA Lycopene_cycl TrkA_N FAD_oxidored NAD_binding_9 3HCDH_N THF_DHG_CYH_C UDPG_MGDP_dh_N Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: AEK38693
UniProt: G0G7Q8
Position
complement(206308..207495)
Genome map
AA seq 395 aa AA seqDB search
MRNVVVVGGGIVGLAVAWELTRRGLDVTVLEKESRWAAHQTGHNSNVVHAGLYYKPGSFK
ARMSVAGNRSIVDFARQYGVPVEVCGKLVVATHEREIPALNTLAERAEANGVPAKQISPA
EAREYEPEVACVAALRVESTGIIDFPAVCHALVRLLDEAGVDLRLNSPAVAIRAGSNGGV
EVATGDDVVQADALVNCAGLHSDRVARLAGLTPSAKIVPFRGEYYELKPDRRHLVKGLIY
PVPDPTLPFLGVHLTRMLDGSVHAGPNAVLALRREGYRWGDFSAKDVAEVAAFPGVWRLA
RKYAFPTGLDEVRRSFSKKRFAASLARLVPAVTEDDIVRHGSGVRAQAMRRDGSLVDDFL
IETARDQVHVLNAPSPAATSALEIARHIADQVSEG
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcaacgtcgtagtcgtcgggggcgggatcgtcggtctggccgtggcctgggagctg
accagacgcgggctggacgtcaccgtcctggagaaggaatcccgctgggcggcacaccag
accgggcacaactcgaacgtcgtgcacgccgggctctactacaagcccggctccttcaag
gcgcggatgtccgtcgccggcaaccggtccatcgtggacttcgcgcggcagtacggcgtg
cccgtcgaggtgtgcgggaagctcgtcgtcgcgacccacgagcgggaaatccccgcgctg
aacacgctcgccgagcgcgccgaggccaacggcgtcccggccaagcagatctcgcccgcc
gaagcgcgcgagtacgagcccgaagtcgcctgcgtcgccgcgttgcgcgtcgaatccacc
gggatcatcgacttcccggccgtctgccacgcgcttgtccggctgctcgacgaagccggt
gtcgacctccggctgaactcccccgccgtggccatccgagccggcagcaacggcggggtc
gaggtcgcgaccggcgacgacgtcgtccaggccgacgcgctcgtgaactgcgccggcctg
cactccgaccgcgtcgcgcggctggccgggctgacgccgtccgcgaagatcgtgccgttc
cgcggggagtactacgagctcaagccggaccggcggcacctggtcaagggcctgatctac
cccgtgccggacccgacgctgccgttcctcggcgtgcacctcacgcgcatgctcgacggc
agcgtgcacgccggcccgaacgccgtgctcgcgctgcgccgcgagggctaccgctggggc
gacttctccgccaaggacgtcgccgaggtcgccgccttccccggcgtctggcggctcgcg
cgcaagtacgcgttcccgaccggcctcgacgaggtccgccgctcgttctccaagaagcgg
ttcgccgcgagcctcgcgcggctcgtgccggccgtcaccgaggacgacatcgtccgccac
ggctccggcgtgcgcgcccaggcgatgcgccgcgacggctcgctcgtcgacgacttcctc
atcgagaccgcgcgcgatcaggtgcacgtcctgaacgcgccgtcgccggccgcgacgagc
gcgctggagatcgcgcgccacatcgcggaccaggtttccgagggctaa

DBGET integrated database retrieval system