KEGG   Amycolatopsis mediterranei S699: RAM_08365Help
Entry
RAM_08365         CDS       T01822                                 

Definition
(GenBank) glycosyl transferase
  KO
K16150  glycogen synthase [EC:2.4.1.11]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00500  Starch and sucrose metabolism
amn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RAM_08365
Enzymes [BR:amn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     RAM_08365
Glycosyltransferases [BR:amn01003]
 Polysaccharide
  Storage polysaccharide
   RAM_08365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_transf_5 Glyco_trans_1_2 Glyco_trans_4_2 Glyco_trans_4_3
Motif
Other DBs
NCBI-ProteinID: AEK40163
UniProt: G0FL68
Position
complement(1757657..1758928)
Genome map
AA seq 423 aa AA seqDB search
MLMLSWEYPPVAIGGLARHVHALATHLTRQGHEVVVLCRHAAGTDAGTHPRTDRVVEGVR
VIRVAEDPMHVTFERDLVAWTLAMGHAMIRAAQDLLRTWQPDVVHAHDWLVAHPAIAIAE
AARVPLVGTIHATEAGRHSGWLSHPLNQQVHSVEWWLANRADALITCSQAMRREVAYLFE
VEAADVTVIHNGIEERGWQVPADEIARAREVYSPAGAPLLLYFGRLEWEKGVQDLLAALP
RIRRRHPGTRVVVAGKGRHFDELVEQSRKLRVRRAVDFVGHLSDRDLRAALAAADAVVLP
SRYEPFGIVALEAAAAKAPLVASTAGGLGEVVVHGETGLAFSPGDVAALASAVTTVLSDA
EAAAERARAAQSRLAADFDWGRIAEATAEVYRRAKPGEPVELPRPKIATGNAFEPVPAEI
PEV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgctgatgctgtcctgggagtacccgcccgtggccatcgggggcctggcccggcacgtc
cacgcgctcgctacccacctcacccgccagggccacgaggtcgtcgtgctctgccggcac
gccgcgggcaccgacgccgggacgcacccgcgcaccgaccgcgtcgtcgagggcgtgcgg
gtcatccgggtcgccgaagacccgatgcacgtgacgttcgaacgggacctcgtcgcctgg
acgctggccatggggcacgccatgatccgcgccgcgcaggacctgctgcgcacctggcag
cccgacgtcgtccacgcgcacgactggctggtcgcccacccggccatcgcgatcgccgag
gcggcgcgggtgccgctggtcggcacgatccacgcaaccgaggcggggcggcactccggt
tggctgtcgcacccgctgaaccagcaggtccactcggtcgaatggtggctcgcgaaccgc
gccgacgcgctgatcacctgctcgcaggcgatgcgccgcgaggtcgcgtacctcttcgag
gtcgaggcggccgacgtcacggtgatccacaacggcatcgaggaacgcggctggcaggtg
cccgcggacgagatcgcccgcgcccgcgaggtctacagcccggccggcgcgccgctgttg
ctctatttcggacgactcgagtgggagaagggcgtgcaggacctgctggccgcgctcccc
cgcatccggcgccgccacccgggcacccgcgtggtcgttgccggaaaaggacgacacttc
gacgagctggtcgagcagtcgcgcaagctgcgggtgcggcgcgcggtcgacttcgtcggg
cacctctccgaccgcgacctccgcgcggcgctggccgcggccgacgccgtcgtgctgccg
agccggtacgagccgttcggcatcgtcgcactggaggccgcggccgcgaaggcaccgctg
gtggcgtcgacggccggcgggctcggcgaggtcgtcgtccacggtgagaccgggctggcg
ttcagtcccggggatgtcgccgcactggcctccgcggtgacaacggtgctctccgacgcc
gaggccgcggccgagcgggcccgggccgcgcagtcccggctggccgcggacttcgactgg
ggccgcatcgccgaagcgaccgccgaggtctaccggcgggcgaagccgggcgaaccggtc
gagctgccccggcccaagatcgccaccggcaacgctttcgaaccggtgccggccgagatc
ccggaagtctag

DBGET integrated database retrieval system