KEGG   Amycolatopsis mediterranei S699: RAM_12465Help
Entry
RAM_12465         CDS       T01822                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00010  Glycolysis / Gluconeogenesis
amn00052  Galactose metabolism
amn00500  Starch and sucrose metabolism
amn00520  Amino sugar and nucleotide sugar metabolism
amn00521  Streptomycin biosynthesis
amn01100  Metabolic pathways
amn01110  Biosynthesis of secondary metabolites
amn01120  Microbial metabolism in diverse environments
amn01130  Biosynthesis of antibiotics
amn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RAM_12465
   00052 Galactose metabolism
    RAM_12465
   00500 Starch and sucrose metabolism
    RAM_12465
   00520 Amino sugar and nucleotide sugar metabolism
    RAM_12465
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RAM_12465
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    RAM_12465
Enzymes [BR:amn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RAM_12465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase
Motif
Other DBs
NCBI-ProteinID: AEK40983
UniProt: G0G7E5
Position
2614327..2615265
Genome map
AA seq 312 aa AA seqDB search
MDVGGTSIRAGVVDERGSLLDTARVATPTEEGALEDAIAGVVEDLRNRHDVAGVGLAVAG
FVARDRRSVMFAPHLAWRGAPVADRIEKRVGLPVLLEHDVNSAIVGEHRFGAARGAQVAA
LVALGTGIGAGLLLDGKLYRGAYGVAPELGHLTVVRGGRPCPCGKYGCWERYCSGTALAA
TAVELLARHPGRSTVLAPQVAGDPGSVTGRRVAGAARDGDPIAQLAMAELAKWLGEGLAL
VADVFDPEIIVIGGGVSESAPLFLDEAREHYAATITGARHRPLARIRTAHLGDDTAIVGA
AALALEAAKTPV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtggacgtcggcgggacgagcatccgggccggcgtggtggacgaacgcggctccctgctc
gacacggcccgcgtcgcgacgccgaccgaggaaggcgccctcgaggacgccatcgccggc
gtggtcgaggacctgcgcaaccggcacgacgtggccggggtcgggctggcggtggcgggc
ttcgtcgcgcgcgaccgccggtcggtgatgttcgccccgcacctggcgtggcgcggcgcc
ccggtcgccgaccggatcgaaaagcgcgtcggcctgccggtgctgctggagcacgacgtc
aattcggcgatcgtcggcgagcaccgcttcggcgcggcccgcggcgcccaggtggcggcc
ctggtggccctgggcacgggcatcggcgcgggactgttgctggacggcaagctgtatcga
ggcgcgtacggcgtcgcgccggagctgggccacctgacggtggtccgcggcggccgcccc
tgcccgtgcggcaagtacggttgctgggagcggtactgcagcggaacggccctggcggcc
acggcggtggagctgctggcgcggcacccgggccgctcgacggtgctggccccccaggtc
gcgggcgacccgggctcggtgacgggccgccgggtggcgggcgcggcccgcgacggcgac
ccgatcgcccagctggcgatggcggaactggccaagtggctgggtgagggcttggcgctg
gtggcggacgtgttcgacccggagatcatcgtgatcggcggcggggtgtcggagtcggcc
ccgctgttcctggacgaggcccgcgagcactacgcggccacgatcacgggcgcccgccac
cggccgctggcccgcatcaggacggcccacctcggcgacgacacggcgatcgtcggtgca
gcggccctggccctggaagcggcgaagaccccggtctga

DBGET integrated database retrieval system