KEGG   Amycolatopsis mediterranei S699: RAM_12510Help
Entry
RAM_12510         CDS       T01822                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00010  Glycolysis / Gluconeogenesis
amn00030  Pentose phosphate pathway
amn00051  Fructose and mannose metabolism
amn00052  Galactose metabolism
amn00680  Methane metabolism
amn01100  Metabolic pathways
amn01110  Biosynthesis of secondary metabolites
amn01120  Microbial metabolism in diverse environments
amn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RAM_12510
   00030 Pentose phosphate pathway
    RAM_12510
   00051 Fructose and mannose metabolism
    RAM_12510
   00052 Galactose metabolism
    RAM_12510
  Energy metabolism
   00680 Methane metabolism
    RAM_12510
Enzymes [BR:amn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RAM_12510
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     RAM_12510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AEK40992
UniProt: Q9AGC0
Position
2622199..2623224
Genome map
AA seq 341 aa AA seqDB search
MRVGVLTGGGDCPGLNAVIRAVVRKGIEVHGWDFVGFRNGWNGPLTGDSRPLGLNDVEDI
LTRGGTILRSSRTNPYKVEGGVDKIKQVLADQGVDALIAIGGEDTLGVAKRLTDDGIGVV
GVPKTIDNDLGATDYTFGFDTAVSIATEAIDRLHTTAESHHRALVVEVMGRHAGWIALHS
GLAGGASVILVPERHFNVDQVVSWVERRFEKEFAPIIVVAEGALPEGGEEKLLTGEKDAF
GHVRLGGIGTWLADEIAHRTGKESRAVVLGHVQRGGTPTAYDRVLATRFGLNAVDAVADG
DFGVMVALKGTDIVRVKLSEATAELKTVPVERYQEAEVFFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtcggtgtgctgaccggcggcggcgactgcccggggctcaacgcggtgatccgc
gcggtggtgcgcaagggcatcgaggtgcacggctgggacttcgtgggcttccgcaacggc
tggaacggcccgctgaccggcgacagccgcccgctgggcctgaacgacgtcgaggacatc
ctcacccgcggcggcaccatcctgcggtcctcgcgcaccaacccctacaaggtcgagggc
ggcgtcgacaagatcaagcaggtcctcgccgatcaaggcgtcgacgcgctgatcgcgatc
ggcggcgaggacaccctcggcgtcgcgaagcggctgaccgacgacggcatcggcgtcgtg
ggcgtgcccaagacgatcgacaacgacctgggcgcgaccgactacaccttcggcttcgac
accgcggtctccatcgcgaccgaggcgatcgaccggctgcacaccacggccgagtcgcac
caccgcgcgctcgtcgtcgaggtcatgggccggcacgccggctggatcgcgctgcactcc
ggcctcgccggcggcgccagcgtcatcctggtgccggagcggcacttcaacgtcgaccag
gtcgtctcctgggtcgagcgccgcttcgagaaggagttcgcgccgatcatcgtcgtcgcc
gagggcgcactgcccgagggtggcgaggagaagctgctgaccggcgagaaggacgccttc
gggcacgtccgcctcggcggcatcggcacctggctggccgacgagatcgcccaccgcacc
ggcaaggagtcccgcgcggtcgtgctgggccacgtccagcgcggcggcaccccgacggcc
tacgaccgcgtcctggccacccgcttcggcctcaacgcggtcgacgcggtcgcggacggc
gacttcggtgtgatggtcgccctcaagggcacggacatcgtccgcgtgaagctgtccgag
gcgacggccgagctgaagacggtcccggtcgagcgctaccaggaagccgaagtcttcttc
ggctga

DBGET integrated database retrieval system