KEGG   Amycolatopsis mediterranei S699: RAM_21490Help
Entry
RAM_21490         CDS       T01822                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00360  Phenylalanine metabolism
amn00362  Benzoate degradation
amn00620  Pyruvate metabolism
amn00621  Dioxin degradation
amn00622  Xylene degradation
amn00650  Butanoate metabolism
amn01100  Metabolic pathways
amn01120  Microbial metabolism in diverse environments
amn01220  Degradation of aromatic compounds
Module
amn_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RAM_21490
   00650 Butanoate metabolism
    RAM_21490
  Amino acid metabolism
   00360 Phenylalanine metabolism
    RAM_21490
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RAM_21490
   00622 Xylene degradation
    RAM_21490
   00621 Dioxin degradation
    RAM_21490
Enzymes [BR:amn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     RAM_21490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AEK42778
UniProt: G0FSX5
Position
4625601..4626488
Genome map
AA seq 295 aa AA seqDB search
MAAIVGPGNIGTDLLAKLRRSEVIEVGYVVGVVESDGLERARAQGIAASADGVDWLLRQD
PVPQLVFEATSAKAHAANAPRYAEAGIQAIDLTPAHLGPMVCPPVNLGAHLDAPNVSMIT
CGGQATIPMVHAVSRVTAVPYAEIVASVASRGAGPGTRANIDEFTRTTSQAVAEIGGAGR
GKAIIILNPVEPPMIMRDTVFCAIGLDADRDAITASIHEMADEVRKYVPGYSLRADPQFD
DAREEWDGHARVGIFLEVRGNGDYLPEYAGNLDIMTAAAARVGELMARAKQEVPA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgatcgtcggccccggcaacatcggcaccgatttgctggcgaagctgcgacgc
agtgaagtgatcgaagtcggttacgtggtcggcgtggtcgagtcggacggtctcgagcgc
gcccgcgcgcaggggatcgcggcgtccgcggacggcgtcgactggctgctgcgccaggat
cccgtgccccagctcgtgttcgaagcgacgtcggcgaaggcgcacgccgcgaacgcgccg
cggtacgccgaagccggcatccaggcgatcgacctgaccccggcgcacctcggcccgatg
gtgtgcccgccggtgaacctcggcgcgcacctcgacgcgccgaacgtttcgatgatcacc
tgcggcggccaggccacgatccccatggtgcacgccgtttcgcgggtgaccgcggtcccg
tacgccgagatcgtcgcctcggtcgcttcgcggggagcgggccccgggacgcgggcgaac
atcgacgagttcacgcgcacgacgtcgcaggcggtggccgagatcggcggtgccgggcgc
ggcaaggcgatcatcatcctcaacccggtcgagccgccgatgatcatgcgggacacggtg
ttctgcgcgatcggcctcgacgccgaccgcgacgcgatcaccgcgtcgatccacgagatg
gccgacgaagtccgcaagtacgtgccggggtattcgctgcgggcggacccgcagttcgac
gacgcacgcgaggaatgggacgggcacgcgcgggtcggcatcttcctcgaggtccgcggc
aacggcgactacctgcccgagtacgccgggaacctggacatcatgaccgccgcggccgcc
cgcgtgggcgagctgatggcccgcgcgaagcaggaggtgccggcatga

DBGET integrated database retrieval system