KEGG   Amycolatopsis mediterranei S699: RAM_23270Help
Entry
RAM_23270         CDS       T01822                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00020  Citrate cycle (TCA cycle)
amn00640  Propanoate metabolism
amn00660  C5-Branched dibasic acid metabolism
amn01100  Metabolic pathways
amn01110  Biosynthesis of secondary metabolites
amn01120  Microbial metabolism in diverse environments
amn01130  Biosynthesis of antibiotics
amn01200  Carbon metabolism
Module
amn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RAM_23270 (sucC)
   00640 Propanoate metabolism
    RAM_23270 (sucC)
   00660 C5-Branched dibasic acid metabolism
    RAM_23270 (sucC)
Enzymes [BR:amn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RAM_23270 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA GARS_A CPSase_L_D2 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AEK43134
UniProt: G0FMI9
Position
complement(5022776..5023918)
Genome map
AA seq 380 aa AA seqDB search
MDLFEHEARELFEKHGVPVPRGRVAADPAAARAAAVALGAPVVIKAQVKTGGRGKAGGVR
VVHTADDAEQAADDILGMDIKGHRVHRVLVTEASEIADEYYLSFLLDRAGRTFLAMASAE
GGMDIEEVAATRPDALVRVPVDPLAGIDATAVAAAFPADVRAEVAGVVEKLWEVFAAEDC
TLVEVNPLALTATGIVALDGKITLDDNAAFRRSSAFDDTSDGDPLEREARAKGLNYVKLD
GDIGVIGNGAGLVMSTLDVVAAAAEAGARGPANFLDIGGGASAQVMVDGLTVILGDPQVR
SVFVNVFGGITACDAVATGIVRSVEVLGSRATKPLVVRLDGNNVTEGRRILAEAAHPLVT
VVATMDDAAREAAKLAIAEG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggacctgttcgaacacgaagcccgcgagctcttcgaaaagcacggcgtaccggtcccc
cgcggccgggtcgccgccgatccggccgcggctcgggccgccgcggtcgccctcggcgcc
ccggtggtgatcaaggcccaggtgaagacgggcgggcgcggcaaggcgggcggcgtccgc
gtggtgcacacggccgacgacgccgagcaggccgccgacgacatcctcggcatggacatc
aagggccaccgcgtgcaccgcgtcctggtcaccgaggcgagcgagatcgcggacgagtac
tacctctccttcctgctcgaccgggccgggcgcacgttcctcgccatggcgtcggccgaa
ggcgggatggacatcgaggaagtcgcggcgacccggcccgacgccttggtccgggtgccg
gtggatccgctggccgggatcgacgcgacggctgtcgcggccgcgttccccgccgatgtc
cgcgccgaagtcgcgggggtcgtcgagaagctgtgggaggtgttcgccgccgaggactgc
acgctcgtcgaggtcaacccgctggcgctcacggcgaccggaatcgtcgcgctggacggc
aagatcaccctggacgacaatgccgcgttccgccgttcttcggcctttgacgacacttcg
gacggtgatccgctggagcgcgaggcccgggcgaagggcctcaactacgtcaagctcgac
ggcgacatcggcgtgatcggcaacggcgccgggctggtgatgtccactttggacgtggtg
gcggccgcggccgaagcgggcgcgcgggggccggcgaacttcctcgacatcggcggcggg
gcgtcggcgcaggtgatggtcgacgggctgaccgtgatcctcggcgacccgcaggtgcgc
agcgtgttcgtcaacgtcttcggcggcatcaccgcgtgcgacgccgtggcgaccgggatc
gtgcggtcagtggaggtcctgggttcgcgggccaccaagccgctggtggtccggctcgac
gggaacaacgtcaccgaaggcaggcggatcctcgccgaagccgcccatcccctggtcacc
gtggtggccaccatggacgatgccgcccgcgaggcggcgaagctcgcgatcgcggagggc
tga

DBGET integrated database retrieval system