KEGG   Amycolatopsis mediterranei S699: RAM_27920Help
Entry
RAM_27920         CDS       T01822                                 

Definition
(GenBank) putative phosphoketolase
  KO
K01621  xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00030  Pentose phosphate pathway
amn01100  Metabolic pathways
amn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:amn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RAM_27920
Enzymes [BR:amn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     RAM_27920
    4.1.2.22  fructose-6-phosphate phosphoketolase
     RAM_27920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XFP_N XFP_C XFP TPP_enzyme_C DUF2563
Motif
Other DBs
NCBI-ProteinID: AEK44061
UniProt: G0G082
Position
complement(6082192..6084537)
Genome map
AA seq 781 aa AA seqDB search
MTALDARPVVLGSTELAQVDALWRAANYLSAGQIYLMANPLLREALRPEQIKPRLLGHWG
TSPGLNFVYAHLNRAILTHDLNAMLVTGPGHGGPALLANTWLEGSYTEAWPDVTRDAAGM
AELFRQFSFPGGVPSHVAPQVPGSIHEGGESGYSLAHAFGAAFDNPGLLVACVVGDGEAE
TGPLATSWHANKFLDPVRDGAVLPILHLNGYKIANPTVLSRIAPAELDALLRGYGYAPIY
VEGYDRELMHQAMAAALDSAVATLAERRGVWPMIVLRSPKGWTGPSVVDGKPVEGTWRAH
QVPLAEVRTNPDHLRQLEEWLRSYRPEELFDSRGRPVADVTTMIPAGERRMGANPHANGG
VLLRPLTLPDIAAHAVAVPRPGATMAEPTRVLGRFLRDVFALNADRANFRLFGPDETASN
RLDAVYDVTGKQWQAAVEPVDEHLSADGRVLEVLSEHLCQGWLEGYLLSGRHGLFSCYEA
FVHIVDSMVNQHIKWLRVHRRIPWRRPVASLNYLLTSHVWRQDHNGFSHQDPGFVDHVAN
KSSEVVRIYFPPDTNTLLEVAAHCLRSRDYVNVVVAGKNDTPNWLDAEQAALHCSRGVSI
WEWASTHTGREPDVVLGCAGDAPTLEVLAAAKILREELPELAVRVVNVVDLMRLQPEAEH
PHGLSDREFDALFTPDRPVIFAYHGYPWLIHRLAYRRTNHHDLHVRGYTEHGTTTTPFDM
LVLNHMDRFQLVIDVIDRVPGLVATAGVLRQRMTEAQGRHGRWIRAHGEDLPEIRDWTWE
G
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgctcgacgcccggcccgtggtgctcggcagcaccgagctggcccaggtggat
gcgctctggcgggccgcgaactacctctcggccggccagatctacctgatggcgaacccg
ctgctgcgcgaggcgctgcgacccgagcagatcaagccgaggttgctcgggcactggggg
acttcacccggcctcaacttcgtctacgcgcatctgaatcgcgcgatcctcacccacgac
ctgaacgccatgctcgtcaccggaccgggtcacggcggcccggccctgctggccaatacg
tggctcgaaggcagctacaccgaggcgtggcccgacgtcacgcgcgacgccgccgggatg
gccgagctgttcaggcagttctccttccccggcggtgtgccgagtcatgtggcgccgcag
gtgcccggctcgatccacgaaggcggggagtcgggttactcgctcgcgcacgccttcggt
gctgcgttcgacaaccccggcctgctggtggcgtgcgtggtcggtgacggcgaggccgag
accgggccgctggcgacgtcctggcacgcaaacaagttcctcgacccggtccgcgacggt
gcggtgctgccgatcctgcacctcaacggctacaagatcgccaacccgaccgtgctctcg
cgcatcgccccggccgagctggacgccctgctgcgcgggtacggctacgcgccgatctat
gtcgagggctacgatcgggagttgatgcaccaggcgatggctgcggcgctcgactcggcg
gtcgccacgctcgccgagcggcgtggcgtgtggccgatgatcgtgctgcgcagccccaag
ggctggaccggtccgtccgttgtggacggaaagccggtggagggcacgtggcgtgcgcac
caggtgccgctggccgaagtccggacgaacccggaccacctgcgccagctggaggagtgg
ctgcgctcgtaccgtccggaggagttgttcgactcccgcggccgtccggtcgcggacgtc
acgacgatgatcccggccggggagcgccggatgggcgcgaacccgcacgccaacggcggc
gtgctgctgcgcccgctgaccctgccggacatcgcggcccacgccgtcgccgtgccgaga
ccgggcgcgacgatggccgagccgacccgggtgctgggccggttcctgcgggacgtcttc
gcgctcaacgccgaccgggcgaacttccgcctgttcggccccgacgagacggcgtccaac
cggctggatgcggtctacgacgtcaccggcaagcaatggcaggcggcggtcgagccggtc
gacgagcacctgtccgccgacggccgcgtgctcgaggtgctctcggagcacctgtgccag
ggctggctcgagggctacctgctgtccggccggcacgggctgttctcgtgctacgaagct
ttcgtccacatcgtcgactcgatggtcaaccagcacatcaagtggctgcgggtgcaccgg
cggatcccgtggcggcgcccggtggcgtcgctgaactacctgctgacttcgcacgtgtgg
cgccaagaccacaacggcttctcccaccaggatcccggcttcgtcgaccacgtcgcgaac
aagagctccgaggtcgtgcggatctacttcccgccggacaccaacaccctgctggaagtc
gccgcgcactgcctgcgcagccgggactacgtgaacgtcgtggttgcgggcaagaacgac
acgccgaactggctggacgccgagcaggcggcgttgcactgctcccgcggcgtgagcatc
tgggagtgggccagcacgcacaccggccgcgaaccggacgtggtcctcggctgcgccggt
gacgctcccacgttggaggtgctggccgcggcgaagatcctgcgggaggaactgccggag
ctggcggtgcgggtggtgaacgtggtcgatctgatgcggctgcagccggaggccgagcac
ccgcacgggctgtcggaccgggagttcgacgcgttgttcacgccggaccggccggtgatc
ttcgcctaccacggctatccgtggctgatccaccggctggcgtaccgccggaccaatcac
cacgacctccacgtgcgcggttacaccgagcacgggacgacgaccacgccgttcgacatg
ctggtgctcaaccacatggaccgcttccagctggtcatcgacgtgatcgaccgggtgccg
ggcctcgtcgcgacggccggggtgctgcggcagcggatgaccgaggcccagggacggcac
gggcggtggatccgggcccacggcgaggatctgcccgagatccgcgactggacctgggaa
ggctga

DBGET integrated database retrieval system