KEGG   Amycolatopsis mediterranei S699: RAM_30480Help
Entry
RAM_30480         CDS       T01822                                 

Definition
(GenBank) phosphoesterase
  KO
K21302  phosphatidylinositol-3-phosphatase [EC:3.1.3.64]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00562  Inositol phosphate metabolism
amn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    RAM_30480
Enzymes [BR:amn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     RAM_30480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-ProteinID: AEK44571
UniProt: G0FW75
Position
6581635..6582510
Genome map
AA seq 291 aa AA seqDB search
MIRKRIFAAFAAATLVTAGAATAAVVTRTDESAAVRPTAAAVPAFDHIVLVMFENKKYSS
INGSSSAPYFNTLASQSAKFTNSFAITHPSQPNYVALFSGATQGVTDDTCPANLGAKANL
GQQLIGAGKTFKGYSEAMPSDGYTGCSSGTYRRKHNSWVDFSNVPATSNLRYSAFPSDFT
QLPTVSFVTPDMCNDMHDCSIGTGDTWLKNHLDAYAQWAKTHNSLLITTFDEDSGTSVNQ
IFTTFTGAGVKVGSYSESINHYTVLRTIEAAYGLPGIGSAASKSPILDVWQ
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcaagcggatcttcgccgcgttcgccgcggccaccctggtcaccgccggcgcc
gccacggcggccgtcgtcacccggacggacgagtccgccgccgtccggccgaccgccgcg
gccgtgccggcgttcgaccacatcgtcctcgtgatgttcgagaacaagaagtactcctcg
atcaacggcagttccagcgccccctacttcaacaccctcgcctcgcagagcgcgaagttc
acgaactccttcgcgatcacccacccgagccagcccaactacgtcgccctcttctccggc
gcgacgcagggcgtcaccgacgacacctgcccggccaacctcggtgcgaaggccaacctg
ggccagcagctgatcggcgcgggcaagaccttcaagggctactccgaagccatgccctcg
gacggctacaccggctgctccagcggcacctaccggcgcaagcacaacagctgggtcgac
ttctcgaacgtccccgccaccagcaacctccgctactccgccttcccgagcgacttcacc
cagctgccgaccgtttcgttcgtcacgcccgatatgtgcaacgacatgcacgactgcagc
atcggcaccggcgacacctggctgaagaaccacctcgacgcctacgcccagtgggccaag
acgcacaacagcctgctgatcaccaccttcgacgaggacagcggcacgtcggtcaaccag
atcttcacgacgttcaccggcgccggcgtcaaggtcggcagctacagcgagtcgatcaac
cactacacggtcctgcgcacgatcgaggccgcctacggcctgcccggcatcggcagcgcc
gcgagcaagtcgccgatcctcgacgtctggcagtaa

DBGET integrated database retrieval system