KEGG   Amycolatopsis mediterranei S699: RAM_32010Help
Entry
RAM_32010         CDS       T01822                                 

Definition
(GenBank) glycine amidinotransferase
  KO
K00613  glycine amidinotransferase [EC:2.1.4.1]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00260  Glycine, serine and threonine metabolism
amn00330  Arginine and proline metabolism
amn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RAM_32010
   00330 Arginine and proline metabolism
    RAM_32010
Enzymes [BR:amn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.4  Amidinotransferases
    2.1.4.1  glycine amidinotransferase
     RAM_32010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidinotransf Ig_Tie2_1
Motif
Other DBs
NCBI-ProteinID: AEK44875
UniProt: G0G3K8
Position
6905289..6906419
Genome map
AA seq 376 aa AA seqDB search
MRTDTRIVNSWNEWDTLQEVVVGTAENACFEPTEPGHRPQERGLSEPRPFPTGPKPRELN
EKAEEELTGLVSLLESQGVTVRRPAPRDYSVPLKTPTFEVENQYCAVCPRDVMITLGNEI
LEATMSRRSRYFEYEAYRSLVYKYWDEDPLMTWSVAPKPSMADDMYRQDFWTWPLSKRHE
EMHNFEFCVTQDEVVFDAADMARMGKDIFVQESMTTNRAGIRWITRHLEPKGFRVHPVHF
PLDYFPSHIDATFIPLRAGLVLTNPERPINSGEEKLFLANDWEFVTAPQPLTGNDEMPRY
CQSSKWVSINVLSISPSKIIVEEQEKPLQDLLCSLGFEVFPLPFRHVYEYGGSLHCATWD
VRRDGVCEDYFPDQNV
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgcggactgacaccagaatcgtcaactcctggaacgagtgggacactctccaggaggtc
gtcgtgggcaccgcggagaacgcctgcttcgagccgaccgagccggggcaccggccccag
gagcgggggctgtccgagccgcgccccttccccaccggcccgaagccccgggagctgaac
gaaaaggccgaagaggaactcaccgggctcgtgtcactgctcgagtcgcagggtgtcacg
gtccgccggccggcgccgcgggactactcggtaccgctgaagacgcccacgttcgaggtg
gagaaccagtactgcgcggtctgcccccgggacgtgatgatcaccctgggcaacgagatc
ctcgaggcgacgatgtcgcggcggtcgcggtacttcgagtacgaggcctaccggagcctg
gtctacaagtactgggacgaagacccgctcatgacctggtcggtggcgccgaagccgtcc
atggccgacgacatgtaccgccaggacttctggacgtggccgctgtcgaagcggcacgag
gaaatgcacaacttcgagttctgcgtgacgcaggacgaggtcgtcttcgacgccgcggac
atggcgcggatgggcaaggacatcttcgtccaggagtcgatgaccaccaaccgcgcgggc
atccggtggatcacccggcacctggagccgaagggcttccgcgtgcacccggtgcacttc
ccgctggactacttcccctcgcacatcgacgccacgttcatcccgctgcgcgcgggcctg
gtgctcaccaacccggagcggccgatcaacagcggcgaggagaagctgttcctggccaac
gactgggagttcgtgaccgcgccccagccgctcaccggcaacgacgagatgccccgctac
tgccagtcgtccaagtgggtgtcgatcaacgtgctgagcatctccccgtcgaagatcatc
gtcgaggagcaggaaaagccgttgcaggacctgctgtgcagcctgggcttcgaggtgttc
ccgctgccgttccggcacgtgtacgagtacggcggctccctgcactgcgccacctgggac
gtccgccgcgacggtgtgtgcgaggactacttccccgaccagaacgtgtga

DBGET integrated database retrieval system