KEGG   Amycolatopsis mediterranei S699: RAM_36980Help
Entry
RAM_36980         CDS       T01822                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase
Organism
amn  Amycolatopsis mediterranei S699
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEK45865
UniProt: G0FNI8
Position
complement(7944208..7945002)
Genome map
AA seq 264 aa AA seqDB search
MIEDPGAVGLGCRWADGVLWLTLDRPEARNALTIAMRRGLITAIRAADADPQTRVVVLTG
TDPAFSAGVDLKESLGAPRGARTDPAEAVRAARAPVLGVINGPCYTGALELALSCDFLVA
SDRARFADTHAALGLVAGWGMSALLPRAVGVRLARQMMLTGEPVDAGQAVRAGLVNEVVP
HERLAERVRQVVAGILAAAPEAADATLQLLADGEDVPLAHALALEARAKRRRRIDVAEVA
RRFAARTAHVSDHNGMMRTGAEDR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgaggatccgggcgccgtcgggctcgggtgccgctgggcggacggggtgctctgg
ctgactctggaccgcccagaggcgcgcaacgcgctgacgatcgcgatgcggcgcggactg
atcaccgcgatccgggcggcggacgcggatccgcagacgcgggtggtcgtgctgaccggg
accgatccggccttctccgcgggcgtcgacctcaaggagtcgctcggggcgccgcgcggc
gcccggaccgacccggcggaggcggtgcgggcggctcgcgctccggtgctcggggtgatc
aacggcccgtgttacaccggagcgctggagctggcgctgtcgtgcgacttcctcgtcgcc
tcggaccgcgcccggttcgccgacacgcacgccgcgctcggcctggtggccgggtggggg
atgagcgcgctgctgccccgggcggtcggcgtgcggctggcccggcagatgatgctgacc
ggcgagcccgtcgacgctgggcaggcggtgcgtgctgggctggtgaatgaggtcgtgccc
cacgagcggctggcggagcgggtccggcaggtcgtggccgggatcctcgccgccgcgccg
gaagcggccgacgccacgctgcagctgctcgccgacggcgaggacgtgcccctggcgcac
gctctcgcgctggaggcgagggcgaagcggcggcggcggatagacgtggcggaggtggcc
cgccggttcgcggcccggaccgctcacgtaagtgaccacaatggaatgatgcgcacggga
gcggaggaccgatga

DBGET integrated database retrieval system