KEGG   Amycolatopsis mediterranei S699: RAM_40560Help
Entry
RAM_40560         CDS       T01822                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00071  Fatty acid degradation
amn00280  Valine, leucine and isoleucine degradation
amn00281  Geraniol degradation
amn00310  Lysine degradation
amn00362  Benzoate degradation
amn00380  Tryptophan metabolism
amn00410  beta-Alanine metabolism
amn00640  Propanoate metabolism
amn00650  Butanoate metabolism
amn00903  Limonene and pinene degradation
amn00930  Caprolactam degradation
amn01040  Biosynthesis of unsaturated fatty acids
amn01100  Metabolic pathways
amn01110  Biosynthesis of secondary metabolites
amn01120  Microbial metabolism in diverse environments
amn01130  Biosynthesis of antibiotics
amn01200  Carbon metabolism
amn01212  Fatty acid metabolism
Module
amn_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RAM_40560
   00650 Butanoate metabolism
    RAM_40560
  Lipid metabolism
   00071 Fatty acid degradation
    RAM_40560
   01040 Biosynthesis of unsaturated fatty acids
    RAM_40560
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RAM_40560
   00310 Lysine degradation
    RAM_40560
   00380 Tryptophan metabolism
    RAM_40560
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RAM_40560
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RAM_40560
   00281 Geraniol degradation
    RAM_40560
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RAM_40560
   00930 Caprolactam degradation
    RAM_40560
Enzymes [BR:amn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     RAM_40560
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RAM_40560
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     RAM_40560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 UDPG_MGDP_dh_N NAD_binding_2 2-Hacid_dh_C F420_oxidored AlaDh_PNT_C NAD_binding_8 NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: AEK46579
UniProt: G0G6H5
Position
complement(8683964..8686135)
Genome map
AA seq 723 aa AA seqDB search
MAESKTIRWDQDSDGIVTLTLDDPNQSANTMNAAFRESLGVTVDRLEAEKDSITGVVITS
AKKTFFAGGDLNDLIQAKPEHAAELTEGSSLMKGQMRRIEQLGKPVVAAINGAALGGGLE
IALATHHRIAADVKGSQIGLPEVTLGLLPGGGGVVRTVRLLGIQSALLNVLLQGQRHRPA
KALELGLVHELVGSVEELVPAAKAWIKANPEGGVQPWDVKGYKIPGGTPSNPSFAANLPA
FPANLRKQIKGANMPAPRAILAAAIEGAQVDVDTALQIETRYFIHLATGQVSKNMTKAFF
FDLQTINSGGSRPDGFEKYTAKKVGVLGAGMMGAAIAYVSAKAGIDVVLKDVSLEAAEKG
KSYAVKLEEKALSRGKTTQEKSDALLAKIKPTGDPADFAGVDFVIEAVFESVELKHKVFG
EIESVVNADAVLGSNTSTLPITTLAEGVQRTEDFIGIHFFSPVDKMPLVEIICGEKTSPA
TLAKVFDYTLQIKKTPIVVNDSRGFFTSRVIGTFINEAVAALGEGVEPASIEQAGAQAGY
PAPPLQLMDELTLTLPRKIRKETREAVEAAGGTWKAHASESVIDRMVEEFDRKGRSTGAG
FYEYDENGKRTGLWPGLRDAFKSGSAEVPFEDLKERMLFAEALETVKCFDEGVLTSVADA
NIGSIFGIGFPAWTGGVIQYINQYEGGLQGFVDRSRELAARYGDHFEPPASLVEKAAKGE
IYE
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggccgagagcaagaccatccgctgggaccaggactccgacggcatcgtcaccctgacc
ctggacgacccgaaccagtcggcgaacacgatgaacgccgccttccgcgagtcgctgggc
gtcaccgtcgaccgcctggaggccgagaaggactccatcaccggcgtcgtcatcacgtcc
gccaagaagacgttcttcgccggcggcgacctgaacgacctgatccaggcgaagcccgag
cacgcggccgagctgaccgagggcagctccctgatgaaggggcagatgcgccggatcgag
cagctcggcaagccggtcgtcgcggcgatcaacggcgccgcgctcggcggtggcctggag
atcgcgctggcgacgcaccaccgcatcgccgccgacgtcaagggcagccagatcggcttg
cccgaggtgacgctgggcctgctgcccggcggcggtggcgtggtccgcaccgtgcggctg
ctcggcatccagagcgcgctgctgaacgtcctgctgcagggccagcggcaccgcccggcc
aaggcgctcgagctcggcctggtgcacgaactcgtcggttcggttgaagagctcgttccc
gccgcgaaggcgtggatcaaggcgaaccccgagggcggcgtgcagccgtgggacgtcaag
ggctacaagatccccggcggcaccccgtcgaacccgagcttcgcggccaacctgccggcg
ttcccggcgaacctgcgcaagcagatcaagggcgcgaacatgccggcgccgcgggcgatc
ctggccgccgcgatcgagggcgcgcaggtcgacgtcgacaccgcgctccagatcgagacg
cgctacttcatccacctcgccaccggccaggtctcgaagaacatgacgaaggcgttcttc
ttcgacctgcagaccatcaactccggcggctcgcggcccgacggcttcgagaagtacacc
gcgaagaaggtgggtgtgctcggcgccgggatgatgggtgccgcgatcgcgtacgtgtcg
gcgaaggccggtatcgacgtcgtcctcaaggacgtctcgctcgaggcggccgaaaagggc
aagagctacgcggtcaagctcgaggagaaggccctctcgcgcggcaagaccacgcaggag
aagtcggacgcactgctggcgaagatcaagccgaccggtgacccggccgacttcgcgggc
gtcgacttcgtcatcgaggccgtcttcgagagcgtcgagctgaagcacaaggtgttcggc
gagatcgaaagcgtcgtcaacgccgacgcggtgctgggttccaacacctcgaccctgccg
atcaccacgctcgccgagggcgtgcagcggaccgaggacttcatcgggatccacttcttc
tcgccggtggacaagatgccgctggtcgagatcatctgcggtgagaagacgtcgccggcc
acgctggccaaggtcttcgactacacgctgcagatcaagaagaccccgatcgtcgtcaac
gacagccgcggcttcttcacctcgcgggtgatcggcacgttcatcaacgaggccgtcgcc
gcgctgggcgagggtgtcgagccggcgtcgatcgagcaggcgggtgcgcaggcgggctac
ccggcgccgccgctgcagctgatggacgagctgacgctgaccctgccgcgcaagatccgc
aaggagacccgcgaggcggtcgaggccgcgggcggcacgtggaaggcgcacgcgtcggag
tccgtgatcgaccggatggtcgaggagttcgaccgcaagggccggtcgacgggcgcgggc
ttctacgagtacgacgaaaacggcaagcgcaccgggctgtggccggggctgcgtgacgcg
ttcaagtcgggctcggccgaggtgccgttcgaggacctcaaggagcggatgctcttcgcc
gaggcgctcgagacggtcaagtgcttcgacgagggtgtgctgacgtcggtggccgacgcc
aacatcggctcgatcttcggcatcggcttcccggcctggacgggcggcgtcatccagtac
atcaaccagtacgagggtggcctgcagggcttcgtcgaccggtcccgcgagctggccgcc
cggtacggcgaccacttcgagccgccggcttcgctggtggagaaggccgccaagggcgag
atctacgaataa

DBGET integrated database retrieval system