KEGG   Amycolatopsis mediterranei S699: RAM_41485Help
Entry
RAM_41485         CDS       T01822                                 

Definition
(GenBank) undecaprenyl pyrophosphate synthase
  KO
K12503  short-chain Z-isoprenyl diphosphate synthase [EC:2.5.1.68]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00900  Terpenoid backbone biosynthesis
amn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amn00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RAM_41485
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:amn01006]
    RAM_41485
Enzymes [BR:amn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.68  (2Z,6E)-farnesyl diphosphate synthase
     RAM_41485
Prenyltransferases [BR:amn01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   RAM_41485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prenyltransf
Motif
Other DBs
NCBI-ProteinID: AEK46764
UniProt: G0FRJ9
Position
complement(8881179..8881937)
Genome map
AA seq 252 aa AA seqDB search
MSDVVYSAYGRRLIQQAAGRHPRHIAIMLDGNRRWAREAGFTDVSDGHRAGAKKIADFLS
WCQEADVEVVTMWLLSTDNLNRDPDELTPLLKIITDVTDELAGPGTAWQLRIVGALDLLP
AEVAKRLSEAAARTEGRTGMEVNIAVGYGGRQEIADAVRKLLRQHADEGTSIHELAKILD
VDHISEHLYTSGQPDPDLIIRTSGEQRLSGFLLWQSAHSEFWFTEAYWPAFRRVDFLRAI
RDYAWRHRRFGS
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
ttgtccgacgtcgtgtacagcgcctacggcaggcgcctcatccagcaggccgccgggcgg
catccccggcacatcgccatcatgctcgacggcaaccgccggtgggcccgtgaagcgggc
ttcacggacgtttcggacggccaccgcgccggggccaagaagatcgcggacttcctgagc
tggtgccaggaggccgacgtcgaggtcgtcaccatgtggctgctgtccaccgacaacctc
aaccgcgacccggacgagctcacgccgctgctgaagatcatcaccgacgtcaccgacgag
ctcgccgggccgggtacggcgtggcagctgcggatcgtcggcgcgctcgacctgctcccc
gccgaggtcgccaagcggctgagcgaagccgccgcccggactgaggggcggaccgggatg
gaggtcaacatcgcggtcggctacggcgggcgccaggaaatcgcggacgcggtgcgcaag
ctgctgcggcagcacgccgacgagggaacgtccattcacgagctggcgaagatcctcgac
gtcgaccacatctccgagcacctctacacctcgggccagccggaccccgacctcatcatc
cgcacctcgggcgagcaacggctctccggcttcctgctgtggcagtccgcgcactcggag
ttctggttcaccgaggcgtactggcccgccttccgccgcgtcgacttcctgcgtgccatc
cgcgactacgcgtggcgccaccgccggttcggctcgtaa

DBGET integrated database retrieval system