KEGG   Amycolatopsis mediterranei S699: RAM_45240Help
Entry
RAM_45240         CDS       T01822                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00010  Glycolysis / Gluconeogenesis
amn00620  Pyruvate metabolism
amn00640  Propanoate metabolism
amn00680  Methane metabolism
amn01100  Metabolic pathways
amn01110  Biosynthesis of secondary metabolites
amn01120  Microbial metabolism in diverse environments
amn01130  Biosynthesis of antibiotics
amn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RAM_45240
   00620 Pyruvate metabolism
    RAM_45240
   00640 Propanoate metabolism
    RAM_45240
  Energy metabolism
   00680 Methane metabolism
    RAM_45240
Enzymes [BR:amn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RAM_45240
Lipid biosynthesis proteins [BR:amn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RAM_45240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEK47515
UniProt: G0G7K4
Position
9672977..9674959
Genome map
AA seq 660 aa AA seqDB search
MTEQSPALDNLLTESRTFPPSEDFAAQANAKADLYAEADADREAFWAKQAERLTWDTKWT
TVLDWTNAPFAKWFVGGKLNVAYNCVDRHVESGHGEQVAIHWVGEPGDTRDITYAELKTE
VSKAANALASLGVTAGDVVAIQLQMVPEAIFAMLACARIGALHNVVFGGFSPTALRARVD
DAAAKVVITSDGQFRRGKAAPMKANVDEALEGAETVEKVIVVKRTGDKLEGDVPWTDGRD
LWWHELVDGQSEEHTPKAFDSEHPLFILYTSGTTGKPKGILHTSGGYLTQTAYTHHNVFD
HKAGEDVYWCTADIGWITGHSYIVYGPLANRVTQVVYEGTPNTPHEGRHWEIIQKYKVSL
YYTAPTLIRTFMKWGAEIPEKYDLSSLRVLGSVGEPINPEAWIWYRENIGAGRTPIVDTW
WQTETGAIMISPLPGVTSTKPGSAQKALPGISAKVVDDQGNEVGPGGGGYLVLDKPWPSM
LRGVWGDEERFKDTYWSRFKDQGFYFAGDGAKYDNDGDIWLLGRVDDVMNVSGHRISTTE
VESALVSHPTVAEAAVVGATDPTTGQGIVAFVILRGNAVDGGEEAIQALRNHVAKEIGPI
AKPRQIMVVPELPKTRSGKIMRRLLRDVAENRQVGDVTTLADSSVMDLISSGLKSGKSEE
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcagtccccagccctggacaacctgctcaccgagagccgcaccttcccgccc
agcgaagatttcgctgctcaggccaacgcgaaggccgacctctacgccgaggcggacgcc
gaccgcgaagcgttctgggcgaagcaggccgagcggctcacgtgggacacgaagtggacc
acggtactggactggaccaatgcaccgttcgcgaagtggttcgtcggcggcaagctgaac
gtcgcctacaactgcgtcgaccggcacgtcgagtccgggcacggcgagcaggtcgcgatc
cactgggtcggcgagccgggtgacacccgggacatcacctacgccgagctgaagaccgag
gtttccaaggccgccaacgcactcgcgtcgctgggcgtcaccgccggcgacgtcgtggcg
atccagctgcagatggtccccgaggccattttcgcgatgctcgcgtgcgcgcggatcggc
gcgctgcacaacgtcgtcttcggcggcttctcgccgacggcgctgcgggcccgcgtcgac
gacgccgccgcgaaggtcgtgatcacctccgacggccagttccgccgcggcaaggccgcg
ccgatgaaggccaatgtcgacgaagcgctcgaaggcgccgaaaccgtcgagaaggtcatc
gtcgtgaagcgcacgggcgacaagctggagggcgacgtcccgtggaccgacggtcgcgac
ctgtggtggcacgagctcgtcgacggacagtccgaagagcacactcccaaagcgttcgac
agcgagcacccgctgttcatcctctacacgtccgggacgaccgggaagccgaagggcatc
ctgcacacctccggcggctacctgacgcagaccgcgtacacgcaccacaacgtcttcgac
cacaaggccggcgaagacgtctactggtgcaccgccgacatcggctggatcaccggccac
agctacatcgtctacggccccctcgccaaccgcgtcacgcaggtcgtctacgaaggcacg
ccgaacaccccgcacgaggggcggcactgggagatcatccagaagtacaaggtctccctc
tactacacggcgccgacgctgatccgcacgttcatgaagtggggcgcggaaatcccggag
aagtacgacctgtcgtcgctgcgggtgctgggctcggtcggcgagccgatcaaccccgag
gcgtggatctggtaccgcgagaacatcggcgccggccggaccccgatcgtcgacacgtgg
tggcagaccgaaaccggcgcgatcatgatctcgccgctgccgggcgtcacctcgaccaag
ccgggctcggcgcagaaggcgctgccgggcatctccgcgaaggtcgtcgacgaccagggc
aacgaggtcggcccgggcggcggcgggtacctggtgctcgacaagccgtggccgtcgatg
ctgcgcggggtctggggcgacgaggagcgcttcaaggacacctactggtcgcggttcaag
gaccagggcttctacttcgccggcgacggcgcgaagtacgacaacgacggcgacatctgg
ctgctgggccgcgtcgacgacgtcatgaacgtgtccggccaccgcatctcgacgaccgag
gtcgagtcggcgctggtctcgcacccgacggtcgccgaggccgcggtcgtcggcgcgacc
gacccgacgaccggccagggcatcgtcgcgttcgtcatcctgcgcggcaacgccgtcgac
ggtggcgaagaggcgatccaggcgctgcggaaccacgtcgcgaaggagatcgggccgatc
gcgaagccgcggcagatcatggtcgtgccggagctgccgaagacgcgttcgggcaagatc
atgcgccgcctgctgcgcgacgtcgcggagaaccggcaggtcggcgacgtcaccacgctg
gccgactcgtcggtgatggacctgatctcgtcgggcctgaagtcgggcaagtcggaggag
tga

DBGET integrated database retrieval system