KEGG   Amycolatopsis mediterranei S699: RAM_46545Help
Entry
RAM_46545         CDS       T01822                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00260  Glycine, serine and threonine metabolism
amn01100  Metabolic pathways
amn01110  Biosynthesis of secondary metabolites
amn01120  Microbial metabolism in diverse environments
amn01130  Biosynthesis of antibiotics
amn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RAM_46545
Enzymes [BR:amn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     RAM_46545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AEK47774
UniProt: G0FRZ0
Position
9924135..9925157
Genome map
AA seq 340 aa AA seqDB search
MTFTPPVLDFRSDTVTRPDETMRAAMASAEVGDNVLERDPTVAELEERAAHVLGMQAALW
VPSGTMANLIALSLHLQRGDRFLATRGAHVLVNELGSAAWLAGGMPDILEHDGGPGRPSP
DTLAAAIGQPGPYFTLRTSLLCLENTHNAAGGAVTPPDEHAQLLSVAKEAGLTVHLDGAR
LWQAAVALEVPPAALTVGVDTVSACFSKGLGAPVGSVVAGSAAFVERARRMRQMLGGGVR
QGGVLAAACLIALDRIPDLAESHENARRLADGLREHGWPANTPDTNIVLAEVPDIPTALA
WLDSLGIRAVQMAGKVRFVTHRDLSATDVEEAVRRIKTGV
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgaccttcaccccgcccgtcctggatttccgctccgacaccgtgacccggccggacgaa
acgatgcgggcggcgatggcctccgccgaagtcggggacaacgtcctcgagcgcgatccc
acggtcgcggagctggaggagcgcgcggcgcacgtcctgggcatgcaggccgcgctctgg
gtgccgagcgggacgatggccaacctgatcgcgctgagcctgcacctgcagcgcggcgac
cggttcctcgccacccggggcgcgcacgtgctggtcaacgagctgggctcggcggcgtgg
ctggccggcggcatgccggacatcctcgagcacgacggcggcccgggccgcccgtcgccc
gacacgctcgcggccgcgatcggacagcccgggccgtacttcacattgcggacatcgctg
ctgtgcctcgagaacacccacaacgcggccggcggcgcggtgaccccgcccgacgagcac
gcccagctgctgtccgtcgccaaggaagcgggcctgaccgtgcacctcgacggcgcccgg
ctgtggcaggccgcggtcgccctcgaagtgccgccggccgcgctgaccgtcggcgtcgac
accgtgtccgcctgtttcagcaagggcctcggcgcgccggtcggctcggtcgtcgcgggc
agcgcggcgttcgtcgagcgggcccgccggatgcggcagatgctgggcggcggcgtccgg
cagggcggtgtcctggccgcggcctgcctgatcgcgctggaccgcatccccgacctggcc
gagtcgcacgagaacgcccggcggctcgccgacggcctccgcgagcacggctggccggcc
aacacgcccgacaccaacatcgtgctcgccgaagtgcccgacatcccgaccgcgctcgcc
tggctcgactcgctcggcatccgggcggtgcagatggcgggcaaggtccggttcgtgacc
caccgggacctgagtgcgaccgacgtcgaagaagccgtacgccggatcaagaccggcgtc
tga

DBGET integrated database retrieval system