KEGG   Acetomicrobium mobile: Anamo_0472Help
Entry
Anamo_0472        CDS       T02151                                 

Definition
(GenBank) translation elongation factor 1A (EF-1A/EF-Tu)
  KO
K02358  elongation factor Tu
Organism
amo  Acetomicrobium mobile
Brite
KEGG Orthology (KO) [BR:amo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:amo03012]
    Anamo_0472
   03029 Mitochondrial biogenesis [BR:amo03029]
    Anamo_0472
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amo04147]
    Anamo_0472
Translation factors [BR:amo03012]
 Eukaryotic Type
  Elongation factors
   Anamo_0472
 Prokaryotic Type
   Anamo_0472
Mitochondrial biogenesis [BR:amo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Anamo_0472
Exosome [BR:amo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Anamo_0472
  Exosomal proteins of breast cancer cells
   Anamo_0472
  Exosomal proteins of colorectal cancer cells
   Anamo_0472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase GTP_EFTU_D4
Motif
Other DBs
NCBI-ProteinID: AFM21126
UniProt: I4BV19
Position
468410..469615
Genome map
AA seq 401 aa AA seqDB search
MAKSKFERVKPHLNIGTIGHIDHGKTTLTAAITRVLSTAGFADFTPFDQIDKAPEERERG
ITISISHVEYQTEHRHYAHIDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHV
LLARQVNVPVIVVFMNKVDMVDDEELLDLVEMEVRELLSSYGFPGDEVPVIRGSALKALE
CGCGKRDCPWCGKIWELMDACDSYIPLPERPVDQPFLMPIEDVFSITGRGTVVTGRVERG
RITPGEEVEIVGMREDKIKTVATSLEMFRKVLDEAIAGDNIGILLRGVDKEDVERGQVVA
KPGTITPHKHFKAEIYVLKKEEGGRHTPFFNGYKPQFYFRTTDVTGEITLPEGVEMVMPG
DNANIEVKLIVPVALEKGLRFAIREGGRTVGAGVVTDILDK
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagtctaagtttgaaagggtaaaaccgcatctaaacataggaaccataggacat
atcgaccacggcaagaccaccttgaccgcagccataacgagggtactgtccacggcaggg
tttgccgacttcacccccttcgaccagatagacaaggcccctgaggagagggaaagaggc
ataaccattagcatatcccacgtggagtatcagaccgaacacaggcactacgcccacatc
gactgccccggacacgccgactacataaagaacatgatcaccggagcagcccagatggac
ggagccatactcgtcgtatctgccgcagacggccccatgccccagacgagggaacacgtc
cttctggcaaggcaggtaaacgtccccgtaatagtggtcttcatgaacaaggtggacatg
gtagacgacgaggaattgctcgacctggtcgagatggaggtaagggagctgctttcaagc
tacggatttcccggagacgaagtgcccgtgataaggggctctgcattgaaggccctcgag
tgcggctgcggcaagagggattgcccctggtgcggaaagatatgggagctcatggacgcc
tgcgacagctacatacctcttcccgagcgaccggtggatcagcccttcctgatgcccata
gaggacgtattctccataacgggccgcggcaccgtcgtgaccggcagggttgagcgcgga
aggataacccccggcgaggaagtagagatcgtgggcatgagggaggacaagataaagacc
gtggccacttcgctcgagatgttcaggaaggtcttggacgaggccatagccggagacaac
atagggatacttttgaggggcgtcgacaaggaggacgttgaaagagggcaggtcgtcgca
aagcccggcaccataacccctcacaagcacttcaaggcggagatatacgtcttgaagaag
gaggaaggcggaaggcacacccccttcttcaacggatataagccacagttctacttcagg
accaccgacgtcaccggcgagataacccttcccgagggagtcgagatggtcatgcccggc
gacaacgccaacatagaggtaaagctgatagtccccgtagccctggagaagggcttgagg
tttgccataagggaaggcggtcgtacggtaggtgccggcgtagtgaccgatatactggat
aagtaa

DBGET integrated database retrieval system