KEGG   Acetomicrobium mobile: Anamo_0670Help
Entry
Anamo_0670        CDS       T02151                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
amo  Acetomicrobium mobile
Pathway
amo00040  Pentose and glucuronate interconversions
amo00052  Galactose metabolism
amo00500  Starch and sucrose metabolism
amo00520  Amino sugar and nucleotide sugar metabolism
amo01100  Metabolic pathways
amo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:amo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Anamo_0670
   00052 Galactose metabolism
    Anamo_0670
   00500 Starch and sucrose metabolism
    Anamo_0670
   00520 Amino sugar and nucleotide sugar metabolism
    Anamo_0670
Enzymes [BR:amo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Anamo_0670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: AFM21319
UniProt: I4BVL2
Position
641659..642534
Genome map
AA seq 291 aa AA seqDB search
MSDVRKCLFPVAGLGTRFLPVTKEIPKEMLPLIDKPVIQYGVEEAVASGCGQIIFITGRG
KRALEDYFDRSYELEQLLKERNKEDLYQLILSISSLADFAYVRQPEPLGLGHAILCAEAF
CNEPFGVILTDDVMISSKPVLRQLIEVREKLGGSVIALERVPHEETERYGIVDACLYSDN
IYKINDLIEKPKREKAPSDLAIMGRYVLSPAVFAHIRNIERGEGGEYQLTDALKSLLKEE
PLWGVVYEGERLDCGTKMGWFKSTIKMGLQDPELRKVVLEILNEEEVSEND
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatgtacgtaaatgtctttttcctgtggctggcttggggacgcgctttttgccc
gtgaccaaggaaatacccaaggagatgctgccgttgatagacaagcccgtgattcagtat
ggggttgaggaggctgtggcctccgggtgcggtcaaataatatttatcacgggaagaggg
aaaagggccctggaagactatttcgacaggtcgtatgagcttgagcagctcttgaaggag
cgcaacaaggaagacctttatcaattgatcttgtcgataagttcattggcagattttgca
tatgtcagacagccggaacctttgggcttaggacatgccatactctgcgctgaagcattc
tgcaatgagccctttggggtgatacttacagacgacgtgatgatctcttctaagcctgtg
ctaagacagctgatagaggttcgcgagaagttgggcggctcggtgattgcccttgaaaga
gtgccccacgaagaaacggagcggtacggcatagtcgacgcctgcttgtattctgataat
atatacaagatcaatgacctgatagaaaaaccgaagagggagaaggcgccgagcgacttg
gccataatgggcagatatgtgctctcccctgcggtgtttgcccatatccgaaacatagag
aggggagaggggggcgagtatcagcttacggatgcccttaaaagcttgctgaaggaagaa
ccgttatggggcgtggtatacgaaggcgaacgcctcgactgtgggaccaagatgggatgg
ttcaagtcaaccataaaaatggggcttcaggatcccgaattaagaaaagtggtgctggaa
atattgaacgaagaagaagtcagcgagaacgactag

DBGET integrated database retrieval system