KEGG   Acetomicrobium mobile: Anamo_1259Help
Entry
Anamo_1259        CDS       T02151                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
amo  Acetomicrobium mobile
Pathway
amo00010  Glycolysis / Gluconeogenesis
amo00020  Citrate cycle (TCA cycle)
amo00620  Pyruvate metabolism
amo01100  Metabolic pathways
amo01110  Biosynthesis of secondary metabolites
amo01120  Microbial metabolism in diverse environments
amo01130  Biosynthesis of antibiotics
amo01200  Carbon metabolism
Module
amo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:amo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Anamo_1259
   00020 Citrate cycle (TCA cycle)
    Anamo_1259
   00620 Pyruvate metabolism
    Anamo_1259
Enzymes [BR:amo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Anamo_1259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N HlyD_3 PYNP_C QRPTase_N PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: AFM21872
UniProt: I4BX65
Position
complement(1233289..1234506)
Genome map
AA seq 405 aa AA seqDB search
MATVITMPKLGLTMTSGSVAKWHKKEGDRVEKGEVILEVSTEKITYKVEAPESGVLRKIL
VQPGTKVPIGTPLCIIAAPDEDISELLKEAPTAPAAEKPAQPEAKPAPVAAKPAGEEVLI
KATPIAKKIAKEQGIDLALVTGTGPGGRIVEKDVLDFIERQKAEAEAKPAAKAAPLKRIA
LSDVRQVIAERMSTSWQNSPMVTLNVDVDCTLLKKLREDLKSSFKEKGLNLSYNYILMKA
CAVALKEQPMLNSYLEGNEVVLYDEVNIGLAVATEEALLVPVVKDVAGKNLYEIASDGDA
LIEKARKGELAIDDVTGGTFTITNLGMFGVRDFTPIINPPQCAILGVGEMKDKPCVCDGQ
IVVKPMMTLSLTFDHRIVDGAQGAMFIRRVKELLENPLLLLAVLK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagtcatcacaatgcccaagcttggcctcaccatgacatccggctcggtggct
aaatggcataaaaaggaaggagacagggtcgaaaagggtgaggtgatcctggaggtctcc
acggaaaagatcacctataaggtcgaagcccccgaaagcggggtgctgagaaagatctta
gttcaaccggggactaaggtgccaatcggtacgcccctttgcataatagccgccccagac
gaagatataagcgagcttttaaaggaagctcctacggctccagcagctgaaaagcccgct
caaccggaagccaagcccgccccggtggctgcaaaaccggcaggcgaagaggttttgatc
aaggccacgcccatcgcaaaaaagatagccaaggaacagggcatcgatttggccctggtt
accggcacgggtccgggtgggaggatagtagaaaaagacgtgcttgacttcatcgaaaga
caaaaggccgaagctgaggcaaagccggcagccaaggcagctccacttaaaaggatagct
ttatccgatgtcaggcaggtaatagccgagaggatgtccacgagctggcagaactcgccc
atggtcacgttaaacgtggacgtagattgcactttgttaaagaaactgcgggaagaccta
aaatcctcttttaaggaaaaggggcttaacctgtcttacaactatatattgatgaaagcc
tgcgccgtcgcattgaaagaacagccgatgctcaattcctacttggaaggcaacgaggta
gttctctacgacgaggttaacatcggccttgccgtggcgacggaggaggcgttgctcgtt
cccgtggtcaaggacgtggccggcaagaacttgtacgaaattgcctctgacggtgatgcc
ttgatcgaaaaggcccgcaaaggcgaacttgctatagacgacgtaacgggtggcaccttt
acgatcaccaacctcgggatgttcggcgttagagacttcactcccatcatcaaccccccg
cagtgcgccatcttgggggttggagagatgaaagacaaaccctgcgtttgcgacggccaa
atagtcgtcaagcccatgatgacgctttctttgaccttcgaccacaggatcgtcgacggc
gctcagggggcaatgtttattaggcgcgtaaaagagctgcttgaaaatcccttgctgctc
ctggctgtcttaaaatag

DBGET integrated database retrieval system