KEGG   Acetomicrobium mobile: Anamo_1434
Entry
Anamo_1434        CDS       T02151                                 

Definition
(GenBank) aerobic-type carbon monoxide dehydrogenase, large subunit CoxL/CutL-like protein
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
amo  Acetomicrobium mobile
Pathway
amo00230  Purine metabolism
amo01100  Metabolic pathways
amo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:amo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Anamo_1434
Enzymes [BR:amo01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     Anamo_1434
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AFM22038
UniProt: I4BXN1
Position
complement(1425416..1427698)
AA seq 760 aa
MSAQRKTIREVQKDAYRKEAYRYVGQNVTRLDAKEKITAAIKYIDDIDMRGMLHIKLLLS
PYANAIVKSIDSTEAESMPGVIKVYSWVNTPKIRYNSAIFYPGQTDLEDETLFSEHMRYV
GDRVAAVVAESKEAAEEGMNRLKVEYDELVPLLDPVKALDQQHEERREVNLSCGDIEKIK
GDTTDLVVVEDEVRTQKIHHAALEPHACIAYMEPGDIVTVLSPCQLIFGVRYIVSKVLDH
PLSKVRVIKWAMGGTFGGKQEVILEPLCAYIAKDLGRPVKLSLNRSETIVATRTRAATVG
KVKTIVSKAGRFIGREVDIVTDAGAYMTGAHRVTTAMGKKLFRLYRIPHQSYKGTTVRTN
TTPSGACRGYGSPQIHTITEINVDHIARELKLDPVELRLRNLVVPFDEDPSGGPNLGNAR
IIECVNRGAEAFCWKERFSFVPQGGRFRRGVGMACSTHSNGYAGSIYPDFTAMNMRLTED
GAVLVNAGLHELGNGTLTVIAQIVAEVLDVNIKKVVVSEGDTMHSPYDVGCVASRVTYVC
GNCAKKLAEEIREKFRALASIVLRVPLNEMTFYDGNIIVKSNKDRAFSYGEVISEIGRTL
QEEVGGYLSYKSVANPGSYAAHFAEVEVDTLTGSVTVIDYLAVHDVGKAINPKLVEGQIY
GGVQMGIGMALFEELTYDSQGNPRNASFSRYTMVNAPEMPNVKVMLVEDEEPSGPFGAKS
VGEIATVPVASAVVNAVNWALGTHLAQLPLTPASIISSIK
NT seq 2283 nt   +upstreamnt  +downstreamnt
ttgagtgctcaaaggaagacgattagggaagtccaaaaagatgcttatagaaaagaggcc
tatagatacgtagggcaaaatgtcacccggttggatgccaaagaaaagataaccgcagcg
ataaagtatatcgatgacattgacatgagagggatgctccacattaagctgcttctttct
ccttatgcaaatgcaattgtaaagtcgatcgattcaacagaagcagaatccatgccaggc
gtcattaaagtgtatagctgggttaatacccctaaaatacgttacaacagcgcgattttt
tatcctggccaaacggacttggaagacgaaacgctcttttcggaacatatgcgatatgtg
ggcgacagagtagctgccgtagtggctgaatctaaagaagctgccgaggaggggatgaac
aggcttaaagtggagtacgatgagcttgttcccctcctagatccggtcaaagctttggac
caacaacatgaggagcgtcgggaagtcaatctctcctgcggtgacattgagaagataaaa
ggcgatacgactgatctggttgtcgtagaagatgaagtacgtacacagaagattcatcat
gcagccctcgagcctcacgcctgcatcgcttatatggaacctggggacatcgtgacagtg
ctgtcgccatgccaacttatttttggagtcagatatatcgtgtctaaggttttagaccat
ccccttagcaaggttcgggttatcaagtgggcaatgggtgggacttttggaggtaaacag
gaagtgatccttgaaccattatgcgcctatatagctaaagatttgggtcgccctgttaaa
ttatcgttaaatcgcagcgagaccatagtggcaacacggacccgtgcggcaactgtgggc
aaggtcaagacaatagtatcaaaagctggcagattcatcggtcgtgaagtcgatatagtc
acagatgcaggagcttatatgacaggtgcacatcgcgttactacggccatgggtaaaaaa
ctctttagactttatcgtatacctcatcaatcatataagggaacgacagtgcggacgaat
acgaccccttcaggtgcctgccgaggttatggctcccctcaaatacatactatcaccgaa
ataaacgtggatcatatcgcaagagagttaaagctagatcccgtcgagctaaggttgaga
aaccttgtagttccttttgacgaggatccttctggaggccctaacttgggaaatgccagg
atcatcgaatgcgttaatcgtggtgcagaagccttttgttggaaagaaaggttttcgttc
gttccccaagggggtaggtttagacgtggcgttggcatggcctgttccactcacagtaac
ggatacgcggggtccatatatccggacttcacggccatgaatatgagattgacagaagat
ggtgctgttttggtcaatgccggacttcatgaattaggcaacggtactttgacggtcatc
gcccagattgtagctgaagtccttgatgtaaatattaagaaagtcgtggttagcgaaggg
gacaccatgcattctccatatgatgtaggatgcgtagcaagcagggtcacctatgtatgc
ggaaattgtgcgaaaaagcttgccgaggaaatcagggaaaagtttcgcgcactggcttct
atcgttttaagggtgcctttaaatgagatgacgttttatgatggcaatatcatagtgaag
tcaaataaagatagggctttttcttacggggaagttatatctgagatcggaaggaccttg
caggaagaggtggggggatacctctcgtataagtcggtggcaaatcctgggtcttacgct
gcgcactttgctgaagtcgaggtcgatacgctgacgggatctgttacggtcattgactat
ctggctgttcatgacgtgggtaaggcaattaatcccaaattggtcgaggggcaaatctac
ggtggggttcaaatgggcataggaatggctttatttgaggagcttacgtatgattcgcaa
ggtaaccctcgaaatgcatccttcagtcgttataccatggtcaatgctccggaaatgccc
aacgtcaaggtcatgcttgttgaagacgaagaaccatccgggccgtttggggccaaaagc
gttggagagatagcgaccgttcctgtagcatctgcggttgtcaatgcagtaaattgggct
cttgggactcatttagcacagctgccactgactcctgccagtatcatttcatctattaaa
taa

DBGET integrated database retrieval system