KEGG   Acetomicrobium mobile: Anamo_1682Help
Entry
Anamo_1682        CDS       T02151                                 

Definition
(GenBank) putative metal-dependent phosphoesterase, PHP family
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
amo  Acetomicrobium mobile
Brite
KEGG Orthology (KO) [BR:amo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Anamo_1682
Enzymes [BR:amo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     Anamo_1682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AFM22276
UniProt: I4BYB9
Position
complement(1693542..1694276)
Genome map
AA seq 244 aa AA seqDB search
MDLHIHTVLSPCAELEMGAKEIVEKCLAEGVDIIAISDHNATANSLAVIEAAKGKPLTVL
PALEVQSREDIHTVSLFPGFEEASLFQEWVWERLAPIKNDPDLFGFQMIIDEDNNILDEV
DTLLIQGIDASVDDIIEEVRRRGGMSILAHIDRQAYSYLAVLGIIPPDLKIDAVELSARL
TSEEALFWKKQALNYTIIRSSDAHRLSDIKRQHATAVLLKRPSFDEIALALHSQDKRMVM
WPWS
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggatctgcatattcataccgtgctgtctccatgtgcagagcttgaaatgggtgccaag
gagatagtcgaaaagtgcctagcagagggggtagatataatagccatctccgatcataat
gctacagcaaattcgctggccgtgatcgaagcggctaagggtaaacctttaacggtgctg
cctgctttggaggttcaatcgcgcgaggacatacatactgtcagtttgtttcctggtttt
gaggaagcatcactttttcaggagtgggtatgggaaaggcttgctccaataaaaaacgat
cctgatttattcggttttcagatgataattgatgaagataataatatactagatgaagta
gatacgcttttgatacaaggcatagacgcatctgtggatgatatcattgaagaagtgagg
agaagggggggaatgtccattttagcgcatatagataggcaggcttattcgtatctggct
gtcttgggaataattccccccgatctaaagatcgatgctgtggagttatcggctaggctg
acctctgaggaggctctgttttggaaaaagcaagctttgaactatacgattattcgatcc
tcagatgcgcatcgtttaagcgacataaagaggcaacacgcaactgcggtccttttaaag
aggccgtctttcgacgaaattgccttagcgcttcattcgcaagacaaaaggatggtgatg
tggccctggtcgtga

DBGET integrated database retrieval system