KEGG   Anaplasma marginale Gypsy Plains: U128_04050Help
Entry
U128_04050        CDS       T02900                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
amp  Anaplasma marginale Gypsy Plains
Pathway
amp00970  Aminoacyl-tRNA biosynthesis
amp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amp00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    U128_04050
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:amp03029]
    U128_04050
Enzymes [BR:amp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     U128_04050
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     U128_04050
Mitochondrial biogenesis [BR:amp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    U128_04050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: AGZ79103
Position
930929..931249
Genome map
AA seq 106 aa AA seqDB search
MSKLSDGAAYSVGHEELARAARLVRLRVPEHEVDRYCEELGNVVAWFNMLSEVDTSGVDP
VLYGGAPGPSQVRDDVVDDGGIRDQVLSHSEVGTEAGCFFVQKIIE
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaactctcagatggagcagcctacagtgtgggacacgaagagctcgctagggcg
gctaggttggtgaggctcagggtaccggaacatgaggttgaccggtactgcgaagagctc
ggaaatgtggtcgcgtggtttaatatgttgtctgaggttgacacatcgggtgtagaccct
gtgctgtacgggggagcacctggtccatcgcaggtacgtgatgacgttgtggatgatgga
ggcatcagagatcaggtactttcccactctgaagtgggcacagaagccggatgttttttc
gtgcaaaagattatagaataa

DBGET integrated database retrieval system