KEGG   Amycolatopsis methanolica: AMETH_0716Help
Entry
AMETH_0716        CDS       T03230                                 

Gene name
adh
Definition
(GenBank) alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
amq  Amycolatopsis methanolica
Pathway
amq00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:amq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AMETH_0716 (adh)
Enzymes [BR:amq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AMETH_0716 (adh)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AMETH_0716 (adh)
    1.1.1.-  
     AMETH_0716 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ThiF FAD_binding_3 ADH_zinc_N Glu_dehyd_C NAD_binding_7 NADH_4Fe-4S Shikimate_DH 3HCDH_N AlaDh_PNT_C NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AIJ20808
UniProt: A0A076MIW4
Position
719494..720075
Genome map
AA seq 193 aa AA seqDB search
MPGHEWSGTVVELGPGTDPELLGKPVVGEGFRNCGRCAPCRRGDTTLCTAEYDETGFTQP
GGWADELRIPARLLHVQPDGADLRAAALLEPAACMAAATLLAAVVPGERVAVIGGGTLGL
LATQLLAASGPAELVVVDPRASRAVPASRFRGATGFYSPGAARAGSTWWWRRRARRARGR
RRCGCAAAAAGWC
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgggcacgaatggtcgggcacggtcgtcgagctggggccgggcacggacccggag
ctgctcggcaaacccgtggtgggcgaggggttccgcaactgtggccggtgcgccccgtgc
cggcgcggcgacacgaccctgtgcaccgccgagtacgacgagacgggcttcacccagccc
ggcgggtgggccgacgagctgcgaattccggcgcggctgctgcacgtgcagcccgacggc
gccgacctgcgtgccgcggcgctgctggaaccggcggcgtgcatggcggcggcgacgctg
ctcgcggcggtcgtgccgggggaacgggtggcggtgatcggcggcggcacgctcggcctg
ctggcgacgcagctgctggcggcgagcggcccggcggaactggtcgtggtggacccgcgg
gcatcccgtgcggtgcccgcgtcccgattccgcggcgcgaccggcttctacagcccgggc
gcggcgcgggcgggttcgacgtggtggtggaggcggcgggcgcgccgggcacgggggcgc
aggcggtgcggatgtgccgccgcggcggccgggtggtgctga

DBGET integrated database retrieval system