KEGG   Amycolatopsis methanolica: AMETH_1157Help
Entry
AMETH_1157        CDS       T03230                                 

Definition
(GenBank) inorganic phosphate transporter PiT family
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
amq  Amycolatopsis methanolica
Brite
KEGG Orthology (KO) [BR:amq00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AMETH_1157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 TMEM141
Motif
Other DBs
NCBI-ProteinID: AIJ21249
UniProt: A0A076MKI8
Position
1185812..1186966
Genome map
AA seq 384 aa AA seqDB search
MIVHPKGTVGGVDLSLIVLVVIVAALAFDFTNGFHDTANAMATSIATGALKPKVAVTISA
ILNLIGAFLSVEVARTISGGIVDDAKVTPVVVFAGLVGAILWNLVTWLVGLPSSSSHALF
GGLIGATWVASGADAVHFAQVVQKVLIPAVASPLVAGLVAIVGTYLVYRITAKVRQDVVS
KSFKRAQVLSASLVSLAHGTNDAQKTMGVITLTLISSGALAAGSGPPLWVVLSAGLAIAL
GTYMGGWRIIHTMGRKITDVQTPQGFAAETSAAATILASSHLGFALSTTHVCSGGIIGSG
VGRRLAEVRWSVAGRMVLAWLLTLPAAAAVGAVAAKVATMGTVGTVVVGLVLVAAALGIW
LWSRRNPVTPQSVAEPEQAVPVAV
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgttcacccgaaaggtaccgtgggaggtgtggacctctcgctgatcgtcctggtg
gtcatcgtcgccgcattggccttcgacttcaccaacggtttccacgacaccgccaacgcc
atggccacctccatcgcgaccggcgccttgaaacccaaggtcgcggtcacgatctccgcc
attctcaacctgatcggcgcgttcctgtcggtcgaggtcgccagaaccatctccggcggc
atcgtcgacgacgcgaaggtcacccccgtggtcgtcttcgccggactcgtcggtgcgatc
ctgtggaacctggtgacctggctggtcggcctgccgtccagctcctcgcacgccctgttc
ggcggcctgatcggcgccacctgggtcgcctccggagccgacgcggtgcacttcgcgcag
gtcgtgcagaaggtcctgatccccgcggtggcctcgccgctggtggccgggctggtcgcg
atcgtcggcacctacctcgtctaccggatcaccgcgaaggtgcggcaggacgtggtgagc
aagtcgttcaagcgcgcgcaggtgctgtcggcgtcgctggtctcactcgcgcacggcacg
aacgacgcgcagaagacgatgggggtcatcacgctcacgctgatctcctccggcgcgctg
gccgccgggtccggaccgccgctgtgggtcgtgctcagcgccgggctggcgatcgcgctg
ggcacctacatgggcggctggcggatcatccacacgatgggccgcaagatcaccgacgtc
cagacaccgcaggggttcgccgccgagaccagcgcggccgccacgatcctggcgtcctcg
cacctcgggttcgcgttgtccaccacccacgtctgctcgggcggcatcatcggatccggc
gtcggacgacggctggccgaggtgcgctggagcgtcgcgggccggatggtgctggcgtgg
ctgctgaccctgcccgctgcggccgcggtcggcgcggtcgcggcgaaggtcgcgaccatg
ggcaccgtcggcactgtggtcgtcggcctggtgctggtcgcggcggcgctgggcatctgg
ctgtggtcgcggcgcaacccggtgacgccgcagtccgtggccgagcccgagcaagccgtt
ccggtggcggtctga

DBGET integrated database retrieval system