KEGG   Amycolatopsis methanolica: AMETH_1615Help
Entry
AMETH_1615        CDS       T03230                                 

Gene name
rrmA
Definition
(GenBank) methyltransferase type 11
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
amq  Amycolatopsis methanolica
Brite
KEGG Orthology (KO) [BR:amq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:amq03009]
    AMETH_1615 (rrmA)
Enzymes [BR:amq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     AMETH_1615 (rrmA)
Ribosome biogenesis [BR:amq03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    AMETH_1615 (rrmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_12 Methyltransf_31 Methyltransf_11 MTS Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: AIJ21707
UniProt: A0A076MV59
Position
complement(1654634..1655479)
Genome map
AA seq 281 aa AA seqDB search
MTRPATLPGAVVAALRCPLCASAFALDGRSLRCPSRHSFDLAKQGYVNLLHAGIPAGTAD
TAEMVAARVAFLGAGHYDGLRDLLAQVAAGTGGDGLVVDAGAGTGYYLAGVLDRLPDAAG
LALDVSAVALRRAAKAHARLGAAVWNLWEPWPVAAETASVVLNVFAPRNAAEFRRVLRPG
GTLLVVSPERGHLAELAAVAPVLDVDPRKEERLDAALSEHFELVSRQSLRDRVTLEPDDV
RNAVRMGPTGHHPERLAALDGVTGPAAVTLAFSLSEYRRTA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaccaggcccgccacgctgcccggcgccgtcgtcgcggcgttgcggtgcccgctgtgc
gcgtccgccttcgccctcgacgggcggtcgctgcggtgcccgtcgcggcactcgttcgac
ctggcgaaacaggggtatgtgaacctgctgcacgccggcatcccggcgggcacggccgac
accgcggagatggtcgccgcgcgggtggcattcctgggcgcggggcactacgacgggttg
cgggatctgttggcgcaggtcgccgcgggcaccggcggtgacggcctggtggtcgacgcg
ggcgccgggacgggttactacctcgccggcgtgctcgatcggctgccggacgcggcgggg
ctcgcgctggacgtttcggcggtcgccctgcgacgggccgcgaaggcgcacgcccgtctg
ggcgcggcggtgtggaacctgtgggagccgtggccggtcgcggcggagacggcttcggtg
gtgctgaacgtgttcgcgccacgcaacgccgccgagttccggcgggtactgcggccgggc
gggactttgctcgtcgtgtcgcccgaacgggggcacctggccgaactcgcggcggtggcg
ccggttctcgacgtggatccgcggaaggaagaacgtctcgacgccgcgttgtcggagcat
ttcgaactggtgtcgcgccagtcgctgcgggaccgggtgacgctggaaccggacgatgtc
cgcaacgccgtgcggatggggcccaccgggcaccacccggagcgcctcgccgcgctcgac
ggcgtgaccgggccggctgcggtgacgctcgcgttttcgttgtcggagtaccggaggacc
gcatga

DBGET integrated database retrieval system