KEGG   Amycolatopsis methanolica: AMETH_2525Help
Entry
AMETH_2525        CDS       T03230                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoylalanine-D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
amq  Amycolatopsis methanolica
Pathway
amq00471  D-Glutamine and D-glutamate metabolism
amq00550  Peptidoglycan biosynthesis
amq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    AMETH_2525 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AMETH_2525 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:amq01011]
    AMETH_2525 (murD)
Enzymes [BR:amq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     AMETH_2525 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:amq01011]
 Precursor biosynthesis
  Amino acid ligase
   AMETH_2525 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M AlaDh_PNT_C Mur_ligase_C TrkA_N NAD_binding_7 AdoHcyase_NAD Shikimate_DH ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AIJ22617
UniProt: A0A076MYF1
Position
2621174..2622568
Genome map
AA seq 464 aa AA seqDB search
MFAGRNVLVAGAGVTGRSAVRALTERGARVTVTDGNAERLAELDGLGAELAPGLTEPPAG
TDLVVTSPGWRPTAPLLVASAAAGIEVIGDVELAWRASRDLPNPATWLAVTGTNGKTTTV
GMLESMLRAGGVHALACGNIGLPVLDAVFEGYEALAVELSSFQLHWSSTLAPHASVVLNL
AEDHLDWHGTMESYAAAKGTIHAHSNVVVHNSDDPWSVRLAGEYAPAGAKRVGFRLDTPR
PGELGLVEDLLIDRAYGPDPQHSADELISVSEVRPAGPHNLANALAAAALARAYGIDPAG
VAKGLREFQPGAHRAVEVGEFGGVRYVNDSKATNPHAAAGSLLAHSSVVWIAGGQLKGAA
VDELVEVVAGRLRGVVLMGADAPVIAAALARHAPDVPVHRVASGDDGAMNEAVSVASDLA
RPGDVVLLAPAGASLDMFRNYAHRGDAFADAVLARASGSADDGR
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgccggacgcaacgtgctcgtcgccggcgccggggtcaccgggcgctcggccgtg
cgggccctgaccgagcgtggcgcccgggtcacggtcaccgacggcaacgccgagcggctg
gccgagctggacggcctgggcgccgaactggccccgggcctcaccgaaccgcccgccggc
accgacctggtggtcaccagccccggctggcggccgaccgcgccgctgctggtcgcctcg
gccgccgcaggcatcgaggtgatcggcgacgtcgagctggcctggcgcgcctcccgggac
ctgccgaacccggccacctggctcgccgtcaccggcaccaacggcaagaccacgacggtg
ggcatgctggagtcgatgctgcgtgccggcggagtgcacgcgctggcctgcggcaacatc
ggcctgccggtgctggacgcggtgttcgagggttacgaggcgctggcggtggagctgtcc
agcttccagctgcactggtcctcgacgctcgcgccgcacgcgtcggtggtgctcaacctc
gccgaggaccacctggactggcacggcacgatggagtcctacgccgccgcgaagggcacc
atccacgcccactcgaacgtcgtcgtgcacaactcggacgatccgtggtcggtgcggctg
gccggcgagtacgcccccgccggggcgaagcgcgtcgggttccggctggacaccccgcgg
ccgggcgagctgggcctcgtcgaggacctgctgatcgaccgcgcctacggcccggacccg
cagcactccgccgacgagctgatctcggtgagcgaggtgcgcccggcgggcccgcacaac
ctcgccaacgccctcgccgcggccgcgctggcccgcgcctacggcatcgaccccgcgggg
gtcgccaagggcctgcgcgagttccagccgggcgcgcaccgagccgtcgaggtgggcgag
ttcggcggggtccgctacgtcaacgactccaaggccaccaacccgcacgccgcggccggg
tcgctgctcgcgcactccagcgtggtgtggatcgcgggcgggcagctcaagggcgccgcg
gtcgacgagctggtcgaggtggtcgccgggcggctgcgtggcgtggtgctgatgggcgcc
gacgccccggtgatcgccgccgctctcgcgcgacacgcgccggatgtccccgtccatcgg
gtcgcctcgggtgacgatggggccatgaacgaggcggtctcggtggccagcgacctggcc
cggcccggtgacgtggtgctgctggcgcccgccggagcgtccctggacatgttccgcaac
tacgcccatcggggtgacgccttcgccgacgcggtcctggcccgtgcctcggggtctgcc
gatgacggtcgttga

DBGET integrated database retrieval system